KEGG   Brucella melitensis bv. 1 16M: BMEII0973Help
Entry
BMEII0973         CDS       T00072                                 

Definition
nitrous-oxide reductase precurser (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BMEII0973
Enzymes [BR:bme01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BMEII0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1010506..1011609)
Genome map
AA seq 367 aa AA seqDB search
MMSSEQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAL
DGIHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYT
TLFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLISLN
KFSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSFWSRE
DPFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVT
NIDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAMHMEMQGRM
LVEPKKA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgagcgagcaggactggattgtcgtcttcaacctgaagcgtatcgaagaagcc
gtcgccaatggcgatttcaaggaaatgaacggtgtgccggtcatcgacggtcgccacggc
tccaaatatacgcgctatattccggtgccgaacagcccgcacggtatcaacaccgcgctg
gacggcatccatgtggtcgccaatggcaagctgtcgccgaccgtgacggtgttcgatgtg
cgcaagttcgacgacctgttcgacgacaagatcaagccgcgcgacgctgttgtggccgag
ccggaactggggcttggaccattgcacacggcctatgatgacaagggcaacgcctatacg
acgctcttcatcgacagccagatctgcaaatggaacattgaagacgccaagcgcgcattc
aagggcgaaaaggtcgatccgatccgtcagaagctcgacgttcattatcagccgggccac
aatcacagctccatgggccaaaccaaggaagttgatggcaagtggctgatttcgctgaac
aagttctccaaggaccgttacctcaatgtcggcccgctcaagcctgagaacgaccagctc
atcgatatttccggcgataagatggtgattgttcacgacggtccgagctttgcggaaccg
catgatgcaacgatcgttcaccgctccaagatcaaccctgtcagcttctggagccgtgag
gatccattttttgccgatgccgtggcgcaggcaaaggcggacggtcttgatctgatggaa
gccaatgaagtggtgcgtgacggcaacaaggtgcgtgtctatatgacgtcttccgcgcct
gccttcggcctcaccgaattcactgtccagcaggatgatgaagtgacggtttatgtcacc
aatatcgatgagatcgaagacctgacccatggtttcgctatcgtcaattacggtgtgaac
atggaagtcgcaccgcaggcgacggcttcggtcacgttcaaggcctccaagccgggtgtg
tggtggtattactgctcgtggttctgccacgccatgcatatggaaatgcagggccgtatg
ctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system