KEGG   Brucella melitensis bv. 1 16M: BMEII1068Help
Entry
BMEII1068         CDS       T00072                                 

Definition
cytochrome c2 precursor
Orthology
K08738  
cytochrome c
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bme00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BMEII1068
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMEII1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1110329..1110679)
Genome map
AA seq 116 aa AA seqDB search
MISTVAQGADIESGKKIFNACKACHQIGEGAKNMVGPELNGLFGRHSGSVEGYKYSDANK
NSGIVWDEEIFRKYIKKPREVIPKTKMVYAGLKDEGKIDDLIAFLKQYDLGGKIKE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttgatctcgactgtcgcgcaaggggcggatatcgaatccggcaagaagattttcaacgca
tgcaaggcttgccatcagattggtgagggggcgaaaaatatggtcggccctgagctcaac
gggctctttgggcgtcactcgggttccgtcgaaggatataagtattccgacgcaaacaag
aattccggaattgtctgggatgaggaaattttccgcaaatacatcaagaagccgcgtgaa
gtgatcccgaagaccaagatggtctatgctggcttgaaggatgagggaaagatcgacgac
ctgattgcatttctcaagcagtatgatctgggcggcaagatcaaggaataa

DBGET integrated database retrieval system