KEGG   Brucella melitensis bv. 1 16M: BMEII1090Help
Entry
BMEII1090         CDS       T00072                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bme  Brucella melitensis bv. 1 16M
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bme00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bme00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1127927..1128835
Genome map
AA seq 302 aa AA seqDB search
MIMVSSDYSVCIVGLGSMGMGVAQSCIAAGLRTYGIDLDPAKCEAIIKAGAIGASSRCEA
AGKLDALVLLVVNAAQCKAVLFGENGLAAQMKPGAAVMVSSTISAADAKEIAAALEAYNL
LMLDAPVSGGAAKAASGDITVMASGSREAFEKLRPVLNAAAGKVYEIGQEIGLGATVKII
HQLLAGVHIAAGAEAMALAARSGIPLDIMYDVVTHAAGNSWMFENRMKHVVDGDYTPKSA
VDIFVKDLRLVTETGLSMNFPLPLATTAYSLFANASNAGFGKEDDAAVIKTYAGIKLPDR
SA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgattatggtgtcttcagattacagcgtatgtatcgtgggcctcggctcaatgggtatg
ggcgtcgcccaatcctgtatcgcggccggtcttcgcacctatggcatcgatcttgatccg
gccaaatgtgaggcgatcataaaggcgggcgcaattggcgcttcatcgcggtgcgaagcg
gcaggaaaactggatgccctggttctgcttgtggtgaatgccgcacaatgcaaggcggtg
ctgtttggagaaaatggccttgccgctcaaatgaaacccggcgccgccgtgatggtttca
tcaaccatctcagccgccgatgccaaggagattgcggcagcactcgaagcctataatctt
ctgatgctggatgcgcctgtttccggcggcgcggcaaaagcggcaagcggggatatcacg
gttatggcttccggttcgcgcgaagctttcgagaaattgcgccccgtgctcaatgccgcc
gctggtaaggtttacgagatcggccaggaaatcgggctgggagcaaccgtcaagatcatc
catcaattgctggcaggcgtacatattgcagccggtgcagaagcaatggcgcttgccgcc
cgttccggcattccgctcgacatcatgtatgacgtggttacacatgcggctggcaatagc
tggatgtttgaaaaccgcatgaaacatgtggtggatggcgattatacgcccaaatccgcc
gtcgatatttttgtcaaggatctgcgcctggtgacggaaaccgggctttccatgaacttc
ccgctgccgcttgcaacaacggcctacagcctgttcgccaatgcctcgaatgccggcttt
ggcaaagaagatgatgccgccgttatcaagacatatgccggcatcaaacttcccgacagg
agtgcatga

DBGET integrated database retrieval system