KEGG   Brucella melitensis biovar Abortus: BAB1_0036Help
Entry
BAB1_0036         CDS       T00304                                 

Definition
cytochrome c heme-binding domain-containing protein
Orthology
K08738  
cytochrome c
Organism
bmf  Brucella melitensis biovar Abortus
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bmf00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:40558..41166
Genome map
AA seq 202 aa AA seqDB search
MNSTRNNKFIMAFLATVFVVMTTGILSDSLFHSPAPEKPGFAIEVAQGSGGGESAAAPAK
KEVSIATLLQSADPARGEVVFKRCQACHTGDKGGANKVGPHLWGVVGRPAASVEGFSYSA
AMKEFGAAGNKWDFEHLNKFLTSPKGFIKGTAMGFAGDKKDNERADLIAYLRTLSDNPVP
LPAADAAPADSDKKPAEAAPAN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaacccggaataacaaatttattatggcatttctggcaacggttttcgttgtc
atgacgacgggcattctgtctgattcgctgtttcattcgccggctcctgaaaagccgggc
tttgccatagaggtagcccaaggttcggggggcggagaaagtgctgcggctcccgccaag
aaagaagtttcaattgcaaccctgttgcaaagtgccgatccggcgcgtggcgaagtggtt
ttcaagcgttgccaggcttgccacaccggggacaagggcggggccaacaaggttggtccg
catctgtggggtgtcgtgggtcgcccggctgcctccgttgaaggtttcagctattccgct
gccatgaaggaattcggcgcggctggcaacaagtgggattttgagcatctcaacaagttc
ctcacctcgccgaaaggcttcatcaagggtacagccatgggctttgccggtgacaagaag
gataatgagcgcgctgacctgattgcttatctgcgcacgctgtccgacaatccggtgccg
ctgccggccgcagacgcagcgcccgcagatagcgataaaaagcccgccgaagctgcaccg
gccaattga

DBGET integrated database retrieval system