KEGG   Brucella abortus 2308: BAB1_0195Help
Entry
BAB1_0195         CDS       T00304                                 

Definition
inositol phosphatase/fructose-1,6-bisphosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmf  Brucella abortus 2308
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BAB1_0195
Enzymes [BR:bmf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BAB1_0195
Transfer RNA biogenesis [BR:bmf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BAB1_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:204491..205291
Genome map
AA seq 266 aa AA seqDB search
MRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAIILAALSSACPDVPVV
AEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVEEGAPVLGIVYAPARN
LLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHLTPETERFLAENRIAS
SVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGMTATLDGRPMIYGQRL
RAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagccgtccttcgcgacgctgcgcttgaggctggccgcagcatcatgaagcattat
gtcaatggatgcgcggtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcac
gcagcggaagccattattcttgcggccctgtcgtcggcctgccccgatgtgccggtggtg
gcggaggaagaagttgcagcagggcgcttgccggatcatctggggcgcaaattccttctg
gtcgatccgctggacggaacccgggaattcctgctgcgcaacggcgattttacggtcaat
atcggccttgtcgaagagggcgcgccagtactgggtatcgtctatgcaccggcccgcaat
ctgctgtttatcggtagcgatgcgggtgcatgggcaatggaaaccacaccggaccatggc
gcaggccaggaccagcggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgt
agccgctcgcacctgacgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagc
agcgtttcggttggttcctcgcttaaattctgcattcttgccaagggtgaggcggatatt
tatccgcgtttcggcccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgc
gcggcgggcggcatgaccgccactctcgacggcaggccgatgatctatggccagcgcctc
cgtgcaggggcggcgggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcg
cctgttttcaccacggcctga

DBGET integrated database retrieval system