KEGG   Brucella melitensis biovar Abortus: BAB1_0906Help
Entry
BAB1_0906         CDS       T00304                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bmf  Brucella melitensis biovar Abortus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:877954..878553
Genome map
AA seq 199 aa AA seqDB search
MRGHSIDDPQLFAAIEATPRQSFLAAAWSHLAYSPRTAPLDCGEYMEGIDDQARVISALK
LEPGHRVLEIGTGSGFTAAVMSLLSGRVTTVERYRKLCDHALQQFVSLKRENIMVKHTDG
RHGMPGGPFDRIVIWLACDEVPRHFVELLATHSVLIAPIGPGDGRQIMTRISKVGSRFEQ
EDLMPVRYQPFIEGTSSVL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgggcacagcattgatgatccgcaactttttgcggcaattgaagcaacgccgcgc
cagagctttctggcggcggcatggtcgcatcttgcctatagcccgcgaaccgcgccgctt
gattgcggtgaatatatggaaggcatagacgatcaggcgcgcgtcatttccgccctgaag
cttgagcccggccatcgggttctggaaatcggcaccggctccggctttaccgccgccgtt
atgtccttgctgtccggccgtgtaacgacggtggaacggtatcgaaaactctgcgaccac
gctctccagcagttcgtttcgctgaagcgcgagaatatcatggtgaaacatacagacggg
cgccacggtatgccgggcgggccgtttgaccgcattgtcatctggctcgcatgcgatgag
gtgccgcgccatttcgttgaactgctcgccacccatagcgtcctgatagccccgatcggc
cctggcgatggacgccagatcatgacgcggatttcaaaggttggaagccgttttgaacag
gaagacctcatgccggttcgatatcagccgttcatcgaaggcacgtcttccgttctttag

DBGET integrated database retrieval system