KEGG   Brucella abortus 2308: BAB1_1051Help
Entry
BAB1_1051         CDS       T00304                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmf  Brucella abortus 2308
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAB1_1051 (folK)
Enzymes [BR:bmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BAB1_1051 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1013036..1013569
Genome map
AA seq 177 aa AA seqDB search
MSTPPKPLRAWLGLGGNIDDPIISMASALRMLDGRSDTRVVSVSPVYRTPPWGKTDQAWF
HNACAQIETALQPLELIAACLDVERSLKRVRLERWGPRIIDIDILVMQDETGRAITMQEP
ALELPHPRMHERAFVLVPLNDIAPSLPVGARTVAEWAADCDRAEMEKARTDAGWWLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactccgccgaaaccattgcgcgcctggcttggcctcggcggcaatatcgatgat
ccgatcatctccatggcgagcgcgcttcgtatgctggatggacggagcgacacgagggtt
gtttccgtatccccggtctaccggaccccgccatggggcaagacggatcaggcctggttc
cacaatgcctgcgcgcaaatcgaaacggccttgcagccactggaactgattgcggcctgt
ctggacgtggagcgatccttgaaacgtgtgcggctggaacggtggggaccacgcatcatc
gatatcgatattcttgttatgcaggatgagacgggcagggcaatcacgatgcaggaaccg
gcattggagcttccgcatccacgtatgcacgagcgagccttcgttctggtgccgctcaat
gatatcgcaccttcgctgcctgtcggcgcgagaactgttgctgaatgggctgccgattgc
gaccgtgcggaaatggaaaaagcccgcacggatgcgggctggtggttggaatag

DBGET integrated database retrieval system