KEGG   Brucella abortus 2308: BAB1_1161Help
Entry
BAB1_1161         CDS       T00304                                 

Gene name
tpiA-1
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00010  Glycolysis / Gluconeogenesis
bmf00051  Fructose and mannose metabolism
bmf00562  Inositol phosphate metabolism
bmf01100  Metabolic pathways
bmf01110  Biosynthesis of secondary metabolites
bmf01120  Microbial metabolism in diverse environments
bmf01130  Biosynthesis of antibiotics
bmf01200  Carbon metabolism
bmf01230  Biosynthesis of amino acids
Module
bmf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAB1_1161 (tpiA-1)
   00051 Fructose and mannose metabolism
    BAB1_1161 (tpiA-1)
   00562 Inositol phosphate metabolism
    BAB1_1161 (tpiA-1)
Enzymes [BR:bmf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAB1_1161 (tpiA-1)
Exosome [BR:bmf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAB1_1161 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   BAB1_1161 (tpiA-1)
  Exosomal proteins of melanoma cells
   BAB1_1161 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAJ11117
UniProt: Q2YRR7
Position
I:complement(1129990..1130754)
Genome map
AA seq 254 aa AA seqDB search
MTPGIRPLVAGNWKMNGKGESLTELRAIAAGLSSDLGRKLDAVICVPATLLSRAAETLEG
ETVGLGGQDAHFKTSGAHTGDISPEMLKEAGATHVILGHSERRTDHHESNKLICAKTEAA
WAAGLVAIVCVGETASERKAERALDVIGDQLSGSLPDGVTAENTIIAYEPVWAIGTGLTP
TVQDVRAAHAFMREQLIERFGAKGAHLRLLYGGSVKPSNAAELLGVADVDGALVGGASLK
AADFLAICETYRNL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactccgggaatccgtccgctggttgctggcaactggaaaatgaatggcaagggagaa
tccctgaccgaactgcgcgccatcgctgcgggcctcagctccgacctcggccgcaagctc
gatgcggtcatatgtgtgccggccaccttgctttcgcgtgcggctgaaacgctggaaggc
gaaacggtcggccttggcggacaggatgcccatttcaagacatccggcgcgcatacgggc
gacatttcgccggaaatgctcaaggaagctggtgccacccatgtcattctcggccattcc
gagcgccgcaccgatcatcacgagagcaataagctcatttgcgccaagacggaagccgca
tgggctgcggggctggtggctatcgtctgcgttggagaaaccgccagcgagcgaaaggcg
gagcgtgcgctcgatgtcattggcgaccagctttccggttcgctgccggatggggttacg
gcggaaaacacaatcattgcctatgaacccgtatgggctatcggcaccgggttgacgccg
acggttcaggatgttcgtgcagcgcacgccttcatgcgtgaacagttgatcgaacgtttc
ggcgcaaaaggcgcgcatctgcgccttctttatgggggttcggtgaagccgtccaatgct
gccgaattgctcggtgttgcagatgttgacggcgctcttgtcggcggcgcgagtttgaag
gcggcagacttcctcgccatatgcgaaacctatcgcaatctataa

DBGET integrated database retrieval system