KEGG   Brucella abortus 2308: BAB1_1484Help
Entry
BAB1_1484         CDS       T00304                                 

Definition
isochorismatase hydrolase family protein (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmf  Brucella abortus 2308
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BAB1_1484
Enzymes [BR:bmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BAB1_1484
    3.5.1.-  
     BAB1_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1436760..1437389
Genome map
AA seq 209 aa AA seqDB search
MIGHALVVIDVQNDFCPGGALAVERGDEIIPIVNRLIGESEKVVVTQDWHPANHSSFASN
HSGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGFRIGIDSYSAF
FENDHCTPTGLGGYLRERNIGSLTMVGLATDFCVASSALDAVQQGFQVRVRLDACRGIDL
NGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccatgcacttgtggttatcgacgtccagaatgatttttgccccggcggcgcc
ttggccgtcgaacgtggcgatgaaatcatcccgatcgtcaaccgcctgatcggggaaagc
gaaaaggtcgtggtcacgcaggattggcatccggccaaccattccagcttcgcctccaac
cactccggcagccgcccgttcgatacggtcaatatgtcttatgggccgcaggtgctctgg
ccggatcattgcgtgcaaaatagcgagggggcagaatttcaccccgatctgcaatggtgg
cgtgcacagcttgtcgtccgcaagggtttccgcattggtatcgacagctactccgcattt
tttgaaaatgaccattgcacgccgacgggccttggcggatatttgcgtgaacgcaatatc
ggatcattgacaatggttggcctcgccaccgatttctgcgtcgccagttcagcgcttgat
gcggtccagcagggctttcaggtgcgggtgcgactcgatgcctgccgcggtattgatctc
aacgggtcgatgaacatcatgctggagaaaatgaaacaggctggcgtcgaactgatcgat
gagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system