KEGG   Brucella abortus 2308: BAB1_1789Help
Entry
BAB1_1789         CDS       T00304                                 

Definition
thiol (cysteine) protease (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmf  Brucella abortus 2308
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BAB1_1789
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAB1_1789
Enzymes [BR:bmf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BAB1_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1722009..1722800
Genome map
AA seq 263 aa AA seqDB search
MTDVSARKTAIVTGSNSGIGLGIAHALAAAGHNVVINSFTDRDEDHALARMLAEEHGANV
IYIAADMSKAEDCRNLIAKTAKVFGNSDILVNNAGIQHVAPVEEFPPEQWDRIIAINLTS
AFHTSAAAIPHMRKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTKTLALELATAK
ITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVTTAQIGAVATF
LASDAAAQINGAAISVDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtatccgcccgcaaaactgcaattgttaccggatcaaattcagggatcggc
ctcggaatcgcccatgcactggcagccgcggggcataacgtcgtaataaactccttcacc
gaccgcgacgaagaccatgcgcttgcccggatgcttgccgaagaacatggtgcgaatgtc
atctatattgccgcggatatgtcgaaagccgaagattgccgcaatctcattgccaaaacc
gccaaggttttcggcaactccgatattctggtcaataatgcgggcatccagcatgtcgcc
ccggtggaagagtttcctcccgagcaatgggaccgcatcatcgcaatcaacctgacatcg
gccttccacacttctgctgctgccatcccccatatgcgaaaggcgggctggggccgtatc
atcaatattgcctcggcgcatggtctcgtggcttcgccgttcaaatcggcatatgtcgcc
gccaagcacggcattgtcggcttcaccaagacgctggcgctggagcttgccaccgcaaaa
atcaccgccaattccatctgtcccggctatgtgctgacccctctggtggaagcgcagata
cccgaccagatgaaagcccaccacatggaccgtgaaaccgtgatccgcgacgtgatgctg
gataaacagccgacgaaggagtttgtcaccaccgcgcaaatcggggccgttgccactttc
ctcgcaagcgatgcggcagcgcagatcaacggtgcagccatttccgtcgacggcggctgg
acggcagaataa

DBGET integrated database retrieval system