KEGG   Brucella abortus 2308: BAB1_1852Help
Entry
BAB1_1852         CDS       T00304                                 

Gene name
proB
Definition
(GenBank) Aspartate/glutamate/uridylate kinase:Glutamate 5-kinase:PUA domain:Glutamate 5-kinase, bacterial form
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00330  Arginine and proline metabolism
bmf00332  Carbapenem biosynthesis
bmf01100  Metabolic pathways
bmf01130  Biosynthesis of antibiotics
bmf01230  Biosynthesis of amino acids
Module
bmf_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAB1_1852 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BAB1_1852 (proB)
Enzymes [BR:bmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BAB1_1852 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF3708
Motif
Other DBs
NCBI-ProteinID: CAJ11808
UniProt: Q2YLM3
Position
I:complement(1789406..1790542)
Genome map
AA seq 378 aa AA seqDB search
MLKKLKDYRRIVVKIGSALLVDRATGLKRKWLESLGQDIAALQHAGVEVLVVSSGAIALG
RTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQILVTLSDTEERRRYLN
ARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATMMGADLLILLSDIDGLYT
APPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKLDAGKIANAAGTAMIITSG
TRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSGKSLLP
AGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARKVAGHKSDEISAILGYDARAA
MIHRNDLVVRAASDAKAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaactgaaagactatcgccgcatcgttgttaaaataggctctgcccttctg
gtggaccgggccacaggcctgaagcgtaaatggctggaaagcctggggcaggatattgcc
gccttgcagcatgcgggcgttgaggtgctggtggtttcgtcgggtgcaattgcactgggg
cgcacggttctgggcctgccgaaaaaggcgctgaagcttgaggaaagccaggcggcggca
gcagccgggcagattgcgctggcgaaggcttatgcggatgtgctgggcggacatggcatc
aagtcgggacagattctggtcacgctttccgatacggaagagcgccgccgctatctcaat
gcgcgcgcaaccatcgagaccctgctgaagctcaaggccgtgccgatcatcaatgaaaac
gatacggtggcaaccaccgaaatccgttatggcgacaatgacaggttggcggcgcgcgtc
gcgaccatgatgggcgcggaccttctgatcctgctttccgacattgacgggctttatacc
gcgccgccgcacaagaatccggatgcgcaatttctgccctttgtcgaaaccatcacgccg
cagatcgaagccatggcgggggcggcagcatccgagctttcgcggggtggcatgaagacc
aagctcgatgcgggcaagattgcaaacgctgccgggaccgcgatgattatcacttcgggc
acgcgtttcggcccgctttcggcaattgaccgaggggagcgtgcgacattgttcgaggct
gcccatgcgccggtcaatgcgtggaagacgtggatttccggcaatctggaaccggctggc
cggttgactgtggatgcgggtgctgtcaaggcgctcaaatccggcaaatcgcttttgcct
gcgggcgtgaaggaagttgacggggatttcgagcgtggcgacacggttgccgtcatgaac
gaggatgggcgggagattgcgcgcggtctgatcgcctatgatgctgctgacgcccgcaag
gttgccgggcataaaagcgatgagatcagtgccattcttggctatgatgcccgcgcggcg
atgatccatcgcaacgatctggtggtgcgggccgccagcgatgcgaaagccgcatag

DBGET integrated database retrieval system