KEGG   Brucella abortus 2308: BAB1_1902Help
Entry
BAB1_1902         CDS       T00304                                 

Definition
(GenBank) unnamed protein product
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmf  Brucella abortus 2308
Pathway
bmf00020  Citrate cycle (TCA cycle)
bmf00190  Oxidative phosphorylation
bmf00650  Butanoate metabolism
bmf01100  Metabolic pathways
bmf01110  Biosynthesis of secondary metabolites
bmf01120  Microbial metabolism in diverse environments
bmf01130  Biosynthesis of antibiotics
bmf01200  Carbon metabolism
Module
bmf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bmf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAB1_1902
   00650 Butanoate metabolism
    BAB1_1902
  Energy metabolism
   00190 Oxidative phosphorylation
    BAB1_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ribophorin_II
Motif
Other DBs
NCBI-ProteinID: CAJ11858
UniProt: Q2YLQ0
Position
I:complement(1852753..1853148)
Genome map
AA seq 131 aa AA seqDB search
MNGMNNDMRIPLGKVRGLGSAKEGTSHFWYQRLSAVALVPLVLFFIGLVISLNGASYAEV
RAALSHPFTAVVMALFVLTGVYHMRLGMQVIIEDYVHGEGMKIVLVMLNTFFTVVVGLAC
VFAILKLSFGG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatgaataacgatatgcgtattccgctcgggaaggttcgcggtctgggttcg
gcaaaagaaggcaccagccatttctggtatcagcgcctgagcgccgttgccctggtgccg
ctggttctgtttttcatcggcctggtcatttcgctcaatggcgcaagctatgcggaagtc
cgggctgccctgtcacatcccttcaccgctgtggtgatggcgctgtttgtcctcacgggc
gtttatcacatgcgcctgggtatgcaggttattattgaagattatgtgcatggcgaaggc
atgaagatcgtgctggtgatgctgaacaccttctttacggtggtggttggtcttgcctgc
gttttcgcgatcctcaagctcagctttggaggttga

DBGET integrated database retrieval system