KEGG   Brucella abortus 2308: BAB1_1958Help
Entry
BAB1_1958         CDS       T00304                                 

Definition
arginase/agmatinase/formiminoglutamase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmf  Brucella abortus 2308
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAB1_1958
Enzymes [BR:bmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BAB1_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1900521..1901534
Genome map
AA seq 337 aa AA seqDB search
MTDKLTSAPKHGHTSMLYSKVHTDLDTLDAHITFLGIPYGSAYTIDEVTNDQTRAPTAVR
QATDRAVRNLDRYDFDVDGPLYNGRAIKAVDCGDVVGDPKDPGAHYRNAEAAVRKILAAG
ALPLIIGGDHGIPIPVLRAYDDQGPITLIQIDAHLDWRDHINGVHDGLSSPIRRASEMAH
VKDIFQIGIRAQGTARPEEYEAARAYGSNIITAYELHDVGMDAILDRIPDGGRYYITIDA
DGIDPSVMPAVAGPAFGGVTYAQTRKLLHGLVKKGRVVGMDIVEITPSKDVNQLTAIAAG
RFFVNLIGAAVRADYFGTKAELETAAGKTMKPAHAAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcttacctccgcgccaaagcatggacatacgagcatgctttattccaag
gttcacacggatctcgacacgctcgacgcccacatcacctttcttggtattccttacggc
tctgcctatacgatcgatgaagtcaccaacgaccagacgcgggcgccgacagcagtgcgc
caggcgaccgaccgtgccgtccgcaacctcgaccggtatgacttcgacgtcgatggccct
ctctacaatggccgtgccatcaaggcggtcgattgcggcgatgtggtgggcgaccccaag
gaccctggcgcacattaccgcaatgcggaagcagccgttcgcaagattctcgccgccggc
gccctgcccctcatcatcgggggcgatcacggcatcccgatcccggtcctgcgcgcctat
gacgatcaggggccgatcaccctgatccagatcgacgcccatctggactggcgtgatcac
atcaatggtgtgcatgacggcctttcaagcccgatccgccgcgcttcggaaatggcgcat
gtcaaggatatcttccagatcggcatccgcgcccagggcacggcacgccccgaagaatac
gaggccgcgagagcttacggctccaatatcatcacagcttacgaattgcatgatgtcggc
atggacgccattctcgatcgtattcccgatggcgggcgctattacatcaccatcgatgcc
gacgggatcgatccttccgtcatgcctgcggtggctggtcccgcctttggcggtgtgacc
tatgcccagacgcgcaaactcctgcatggccttgtcaagaaggggcgcgtcgtcggcatg
gatatcgtggagattacgccttccaaggatgtaaaccagcttaccgcgatcgccgccgga
cgtttcttcgtcaacctgattggtgctgccgtgcgcgccgactatttcggcacgaaagca
gagcttgaaacggccgctggcaaaaccatgaaaccggcccacgccgcagcctga

DBGET integrated database retrieval system