KEGG   Brucella melitensis biovar Abortus: BAB1_2167Help
Entry
BAB1_2167         CDS       T00304                                 

Gene name
truB
Definition
tRNA pseudouridine synthase B (EC:4.2.1.70)
Orthology
K03177  
tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
bmf  Brucella melitensis biovar Abortus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2103455..2104429
Genome map
AA seq 324 aa AA seqDB search
MARRGKKKGRPISGWVIFDKPKGMGSTEAVSKIKWLFSAEKAGHAGTLDPLASGMLPIAL
GEATKTVPYVMDGTKVYRFTVTWGEERSTDDLEGQPTKTSDKRPSREEVEALLPDYTGVI
SQVPPQFSAIKIDGERAYDLAREGETVEIPAREVEIDRLEIVGFPDADRTEFEVECSKGT
YVRSLARDMGRDLGCYGHISDLRRVEVAPFTDEDMVTLAKLEAVWPPLPPKDEDGNVIEP
APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNPVILRGRDAPLEADEACVTT
RGKLLAIGYIEHGQFKPKRVFTAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacggggcaagaaaaaaggtcgcccgatatccggctgggtcatttttgacaag
ccgaagggaatgggatcgaccgaggcggtctcgaagatcaagtggcttttcagtgctgaa
aaggctggccatgcgggcacgctcgatccgcttgcttcgggcatgttgcccatcgcgctt
ggcgaagccacgaagacggtgccttatgtcatggacggaaccaaggtctatcgttttacg
gtgacatggggcgaggagcgttccacggacgatctggaaggccagcccaccaaaacttcc
gacaagcgtccgtcgcgtgaggaagtggaagcactcctgccggattataccggcgtgatc
tcgcaggttccgccgcagttttccgcaatcaagatcgatggcgagcgcgcttatgatctg
gcccgcgagggtgaaaccgtggaaattcccgcccgtgaggtcgagatcgaccgccttgag
atcgtaggctttcccgatgccgaccgtaccgaatttgaggtggaatgctccaagggtacc
tatgtgcgctcgcttgcgcgcgacatggggcgcgatctcggctgctatggtcatatttcc
gatctgcgccgtgtggaagttgcgcccttcaccgatgaagatatggtgacgctcgcaaag
cttgaggctgtctggccgccgcttccgccgaaggatgaggacggcaatgtgatcgagcct
gcaccgcggcgcgatttctccgcgcttgatgcgctggtgatcgatacgggtgcggcactt
gattgtctgccgcaagtgccgctctccgacgatcaggcccagcgggtgcgccttggcaat
ccggtcatcctgcgcgggcgcgatgcgccgctggaagccgacgaggcctgcgttaccacg
cgcggcaagcttctcgccatcggctatatcgagcacgggcagttcaagccgaaacgggtt
ttcaccgccggctga

DBGET integrated database retrieval system