KEGG   Brucella abortus 2308: BAB1_2185Help
Entry
BAB1_2185         CDS       T00304                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmf  Brucella abortus 2308
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAB1_2185
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAB1_2185
   00650 Butanoate metabolism
    BAB1_2185
  Lipid metabolism
   00071 Fatty acid degradation
    BAB1_2185
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAB1_2185
   00310 Lysine degradation
    BAB1_2185
   00360 Phenylalanine metabolism
    BAB1_2185
   00380 Tryptophan metabolism
    BAB1_2185
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAB1_2185
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAB1_2185
   00281 Geraniol degradation
    BAB1_2185
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAB1_2185
   00627 Aminobenzoate degradation
    BAB1_2185
   00930 Caprolactam degradation
    BAB1_2185
Enzymes [BR:bmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAB1_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2119778..2120551
Genome map
AA seq 257 aa AA seqDB search
MAYETIIVETRDSVGLIRLNRPQALNALNRAVLEELTDALAAFDADGKVGAVVLTGSEKA
FAAGADIKEMQSINFVDAYLQDMFADWQKVDRIRKPIIAAVSGYALGGGCELAMMCDFII
AGSNAKFGQPEITLGVIPGMGGSQRLTRYVGKSKAMDMCLTGRMMDAAEAERCGLVSRVV
APEALLEEALKAAERIASFSRVSVYMAKEAVNRAYETTLDEGLRFERRLFHSLFATEDQK
EGMSAFVDKRTPSFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctatgaaacaatcatcgttgagacgcgtgacagcgttggtctcatccgtctcaac
cgtccgcaggcgctcaacgcgctcaatcgcgccgtgcttgaggagctgaccgatgcgctt
gccgccttcgacgcggatggcaaggtcggcgccgtggtgctgaccggctcggaaaaggct
ttcgccgccggggccgacatcaaggaaatgcagtcgatcaatttcgtcgatgcctatttg
caggacatgttcgccgactggcagaaggtggatcgtatccgcaagccgattatcgcggct
gtttcgggctatgcgctgggcggcggctgcgaactcgccatgatgtgcgatttcatcatc
gcgggcagcaatgcgaaattcggccagccggaaatcacgctgggcgtcattcctggcatg
ggcggctcgcagcgcctgacgcgctatgtcggcaagtccaaggctatggatatgtgcctg
acgggccgcatgatggatgcagccgaagcggagcgttgcggccttgtttcccgcgttgtc
gcaccggaggctcttctggaagaggcactgaaagcagccgaacgcatcgcatccttctcg
cgcgtctcggtctatatggccaaggaagcggtcaaccgcgcctatgaaacgacgctggac
gagggcctgcgtttcgagcgccgcctgttccattcgcttttcgcgaccgaagaccagaag
gaaggcatgtccgctttcgttgataaacgtaccccttccttcaagaaccgctga

DBGET integrated database retrieval system