KEGG   Brucella abortus 2308: BAB2_0004Help
Entry
BAB2_0004         CDS       T00304                                 

Definition
ribokinase:carbohydrate kinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bmf  Brucella abortus 2308
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAB2_0004
Enzymes [BR:bmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BAB2_0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2092..3033
Genome map
AA seq 313 aa AA seqDB search
MSHGEAPLKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGA
IRFVGAVGHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGAN
ARWSSADIDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMA
DLIALSDIISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLITAD
EVKHFTPFKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYSSAAGAIAVTRVGAGAAA
PTAREVEELIGRA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagccatggagaagccccgttgaagattttcgttttcggcagtgtgaatgtggatgta
agcgcccgaatggctgccctgccgcggccggggcagacggtaaacgcatccggctatggc
atcgggctgggtggcaaaggagccaatcaggcggttgcggtggcaaaacttggcggggca
atccgatttgtcggcgcggtcggccatgatgcctttggcgaactggccttaaagcagatg
cgcgagtttgggctggataccggcagcgtgcgcgtgatcgatgacgtcgatacaggcatg
gcgatcatccaggtggaggaaaccgggcagaacacgattgcggtctgtgctggcgccaat
gcgcgctggtcgtcagccgatattgatgcttatggcgctgatattgccaaggcaaggatt
acgcttttgcagcgcgaagtgccgcatgaagccaatctggccgttgcgaaagccgtgcgg
gcagcgggtggaaccgtcctgctcgacccggccccggtgggggatgcaagccagatggcc
gatcttatcgccctgagcgacatcatttcgcccaacgagacggaagccgctgaaatcacc
ggcattgagccgaccgacctcgcttcggcggaagcggcggggcgcaagcttctggagcgc
ggcccgaagatcgtcatcctcaagcttggaagccgtggcgcgctgctgataacggcggat
gaggtgaaacacttcacgccgttcaaggtaaaggtggtggatacggttgcagccggtgac
agtttcaacggcggctttgccgttgctttctcgcaggcgcggcccttgcatgattgcgtg
cggtatagttcggcggcgggcgcgattgcggttacgcgggttggcgcaggcgctgccgcg
ccaaccgcgcgtgaggttgaggaactcatcgggcgcgcttga

DBGET integrated database retrieval system