KEGG   Brucella melitensis biovar Abortus: BAB2_0928Help
Entry
BAB2_0928         CDS       T00304                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmf  Brucella melitensis biovar Abortus
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bmf00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BAB2_0928 (nosZ)
Enzymes [BR:bmf01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BAB2_0928 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(906338..908257)
Genome map
AA seq 639 aa AA seqDB search
MTEETRKSQLSRRQLLGTSAFVAAAGASGLGGALLAGSSETALAAGAAKGGMSPEVKPGE
LDEYYVFFSSGQCGEVRIVGLPSMRELMRIPVFNRDSATGWGLTNESRKVLTEGLLPQDR
EFLKDRGDIFLNGDLHHPHPSFTDGTYDGRYLYANDKANTRVCRIRLDVMKCDKIIQLPN
QHTVHGLRVQKYPKTGYVFCNGEDRVPIPNDGSHLNDVKQYHAIFTAVDGETMKVAWQVM
VDGNLDNVDCDYQGKYAFSTCYNSEEGTTLAEMMSSEQDWIVVFNLKRIEEAVANGDFKE
MNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPDGIHVVANGKLSPTVTVFDVRKFDDLFD
DKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTTLFIDSQICKWNIEDAKRAFKGEKVDPI
RQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNKFSKDRYLNVGPLKPENDQLIDISGDKM
VIVHDGPSFAEPHDATIVHRSKINPVSFWSREDPFFADAVAQAKADGLDLMEANEVVRDG
NKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTNIDEIEDLTHGFAIVNYGVNMEVAPQAT
ASVTFKASKPGVWWYYCSWFCHAMHMEMQGRMLVEPKKA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaaaccaggaaatcgcagctcagtcgaagacaattgctcggaacatcggca
tttgtcgcggcagccggtgcaagcgggctcggcggggctctgcttgccggttccagcgaa
actgcgcttgcggctggcgccgcaaagggcggcatgagccccgaagtcaagccgggggaa
ctggacgaatattacgtcttcttctccagcggccagtgtggtgaagtgcgtattgtcggc
ctgccgtcgatgcgtgagctgatgcgcatcccggtcttcaaccgtgacagcgccaccggt
tggggcctgacgaatgaaagccgcaaagtgttgacggaaggcctgcttccgcaggatcgt
gaattcctcaaggatcgcggcgacatcttcctcaatggcgacctgcaccacccgcatccc
tctttcaccgatggaacctatgacggtcgttatctttatgccaacgacaaggccaatacg
cgcgtctgccgtatccgcctcgacgtgatgaagtgcgacaagatcattcagttgccgaac
cagcatacggttcacggcctgcgtgtgcagaaatatccgaagaccggctatgtcttctgt
aatggcgaagaccgtgtaccgatcccgaatgatggcagccacctgaatgacgtcaagcag
taccatgccatcttcaccgccgttgacggtgaaacgatgaaggtcgcctggcaggtgatg
gtcgatggcaatctcgacaatgtggattgcgactatcagggcaaatatgccttctctacc
tgctataattcggaagaggggacgacccttgccgaaatgatgtcgagcgagcaggactgg
attgtcgtcttcaacctgaagcgtatcgaagaagccgtcgccaatggcgatttcaaggaa
atgaacggtgtgccggtcatcgacggtcgccacggctccaaatatacgcgctatattccg
gtgccgaacagcccgcacggtatcaacaccgcgccggacggcatccatgtggtcgccaat
ggcaagctgtcgccgaccgtgacggtgttcgatgtgcgcaagttcgacgacctgttcgac
gacaagatcaagccgcgcgacgctgttgtggccgagccggaactggggcttggaccattg
cacacggcctatgatgacaagggcaacgcctatacgacgctcttcatcgacagccagatc
tgcaaatggaacattgaagacgccaagcgcgcattcaagggcgaaaaggtcgatccgatc
cgtcagaagctcgacgttcattatcagccgggccacaatcacagctccatgggccaaacc
aaggaagttgatggcaagtggctgatttcgctgaacaagttctccaaggaccgttacctc
aatgtcggtccgctcaagcctgagaacgaccagctcatcgatatttccggcgataagatg
gtgattgttcacgacggtccgagctttgcggaaccgcatgatgcaacgatcgttcaccgc
tccaagatcaaccctgtcagcttctggagccgtgaggatccattttttgccgatgccgtg
gcgcaggcaaaggcggacggtcttgatctgatggaagccaatgaagtggtgcgtgacggc
aacaaggtgcgtgtctatatgacgtcttccgcgcctgccttcggcctcaccgaattcact
gtccagcaggatgatgaagtgacggtttatgtcaccaatatcgatgagatcgaagacctg
acccatggtttcgctatcgtcaattacggtgtgaacatggaagtcgcaccgcaggcgacg
gcttcggtcacgttcaaggcctccaagccgggtgtgtggtggtattactgctcgtggttc
tgccacgccatgcatatggaaatgcagggccgtatgctcgtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system