KEGG   Brucella melitensis M5-90: BM590_A0032Help
Entry
BM590_A0032       CDS       T01849                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bmg  Brucella melitensis M5-90
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BM590_A0032
DNA repair and recombination proteins [BR:bmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BM590_A0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(37646..38251)
Genome map
AA seq 201 aa AA seqDB search
MSKRIAGPEIERLIQLLARVPGLGPRSARRAALHLIKKKEALLVPLGGAMQEAAEKVRIC
SCCGNVDTSDPCTICTDERRDPATLIVVEDVSDLWALERADTMNVRYHVLGGRLSPLDGI
GPDDLNIKGLVERVASGAIKEVILAVNATVEGQTTAHYITDQLSNFDMRVTRLAHGVPVG
GELDYLDEGTLAAALRARTTL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaatagccggtcctgaaatcgaacgtctgatccagcttctggcccgcgtg
ccggggctcggaccgcgctcggcccgccgtgcggcgctgcatctcatcaaaaagaaggaa
gcgcttctggtgccgcttggcggcgccatgcaggaggccgctgaaaaggtgcgcatctgt
tcgtgttgcggcaatgtcgatacgtccgacccgtgcacgatctgcaccgatgagcgccgc
gatccggcaactttgattgtcgtggaggacgtatccgatctctgggcgctggagcgggca
gacacaatgaatgtgcgctatcatgtattgggtggccgcctgtcaccgctcgatggcatc
ggcccggacgatctcaacatcaaggggctggtggagcgggttgcaagcggcgccatcaag
gaagtgatcctcgcggtcaacgccactgtcgaaggccagacgaccgcccattacatcaca
gaccagctatcgaatttcgatatgcgcgtgacacggcttgcccatggcgttcccgttggc
ggcgaacttgactatctggatgaaggcacgcttgctgctgcgttacgggcgcgaaccacg
ctttaa

DBGET integrated database retrieval system