KEGG   Brucella melitensis M5-90: BM590_A0203Help
Entry
BM590_A0203       CDS       T01849                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bmg  Brucella melitensis M5-90
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bmg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:206633..207478
Genome map
AA seq 281 aa AA seqDB search
MKISASPKAGLDGTALRAVLRDAALEAGRSIMKHYVNGCAVQSKKDASPVTEADHAAEAI
ILAALSSACPDVPVVAEEEVAAGRLPDHLGRKFLLVDPLDGTREFLLRNGDFTVNIGLVE
EGAPVLGIVYAPARNLLFIGSDAGAWAMETTPDHGAGQDQRIFARVSPAEKVAVCSRSHL
TPETERFLAENRIASSVSVGSSLKFCILAKGEADIYPRFGPTMEWDTAAGDAVLRAAGGM
TATLDGRPMIYGQRLRAGAAGFANPDFVAYGAGEAPVFTTA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttccgcctctccaaaagcaggccttgatggcacagccttgcgagccgtcctt
cgcgacgctgcgcttgaggctggccgcagcatcatgaagcattatgtcaatggatgcgcg
gtgcagagcaagaaggatgcctcgcccgtaaccgaggcggatcacgcagcggaagccatt
attcttgcggccctgtcgtcggcctgccccgatgtgccggtggtggcggaggaagaagtt
gcagcagggcgcttgccggatcatctggggcgcaaattccttctggtcgatccgctggac
ggaacccgggaattcctgctgcgcaacggcgattttacggtcaatatcggccttgtcgaa
gagggcgcgccagtactgggtatcgtctatgcaccggcccgcaatctgctgtttatcggt
agcgatgcgggtgcatgggcaatggaaaccacaccggaccatggcgcaggccaggaccag
cggatttttgcgcgggtttcgcccgccgaaaaagtggctgtctgtagccgctcgcacctg
acgcctgaaaccgaacgatttctcgctgaaaaccgcatcgcaagcagcgtttcggttggt
tcctcgcttaaattctgcattcttgccaagggtgaggcggatatttatccgcgtttcggc
ccgacgatggaatgggacacggcggcgggcgatgcggtgctgcgcgcggcgggcggcatg
accgccactctcgacggcaggccgatgatctatggccagcgcctccgtgcaggggcggcg
ggtttcgccaatcccgatttcgtggcctatggggcgggtgaggcgcctgttttcaccacg
gcctga

DBGET integrated database retrieval system