KEGG   Brucella melitensis M5-90: BM590_A0481Help
Entry
BM590_A0481       CDS       T01849                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmg  Brucella melitensis M5-90
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BM590_A0481
Enzymes [BR:bmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BM590_A0481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:483313..483930
Genome map
AA seq 205 aa AA seqDB search
MVVISSPSGAGKSTIARLLLEDPKMKLSLSISVTTRQRRPSEIDGVHYHFITIREFERLR
DNDELIEWAEVHGNFYGTLRETAEIALADGQDMLFDIDWQGADQLQAKMPADVVSIFILP
PTMRELQQRLNRRAEDTAEVIETRLQNARFEIQKWVKYDYIVINEDLDRSYAAIKSIINA
ERLRRDRRPGLFDFVTGLLEEDPGM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgatctcgtcgccgtcgggtgcgggaaaatccaccattgcccggctgcttctg
gaagacccgaagatgaagctctcgctctccatcagtgtgacgacgcgccagcgtcgcccg
agcgagattgacggcgtacattatcatttcatcacgatccgcgaattcgagcgcctgcgc
gacaatgacgagctgatcgaatgggccgaagtgcacggcaatttttatggtacgctgcgc
gaaacggccgagattgcgctggccgatgggcaggacatgctgttcgatatcgattggcag
ggggcggaccaattgcaggccaagatgccagccgatgtggtgtcgatcttcatcctgccg
ccgaccatgcgcgaattgcagcagcgtctcaaccggcgcgccgaagacacggcggaagtg
atcgaaacgcgcctgcagaatgcgcgctttgaaatccagaaatgggtgaaatacgactat
attgtcatcaatgaagacctcgaccgttcctatgcggcgatcaagtcgatcatcaatgcg
gagcggctgcgccgtgaccgccgccccggcctgtttgattttgtcacggggcttctggag
gaagatccggggatgtga

DBGET integrated database retrieval system