KEGG   Brucella melitensis M5-90: BM590_A1464Help
Entry
BM590_A1464       CDS       T01849                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bmg  Brucella melitensis M5-90
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BM590_A1464
Enzymes [BR:bmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BM590_A1464
    3.5.1.-  
     BM590_A1464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1442534..1443193
Genome map
AA seq 219 aa AA seqDB search
MLGNNKAEHPMIGHALVVIDVQNDFCPGGALAVERGDEIIPIVNRLIGESENVVVTQDWH
PANHSSFASNHSGSRPFDTVNMSYGPQVLWPDHCVQNSEGAEFHPDLQWWRAQLVVRKGF
RIGIDSYSAFFENDHCTPTGLGGYLRERNIGSLTMVGLATDFCVASSALDAVQQGFQVRV
RLDACRGIDLNGSMNIMLEKMKQAGVELIDEPVSASHLL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgctcggcaacaacaaagcggagcatcccatgatcggccatgcacttgtggttatcgac
gtccagaatgatttttgccccggcggcgccttggccgtcgaacgtggcgatgaaatcatc
ccgatcgtcaaccgcctgatcggggaaagcgaaaatgtcgtggtcacgcaggattggcat
ccggccaaccattccagcttcgcctccaaccactccggcagccgcccgttcgatacggtc
aatatgtcttatgggccgcaggtgctctggccggatcattgcgtgcaaaatagcgagggg
gcagaatttcaccccgatctgcaatggtggcgtgcacagcttgtcgtccgcaagggtttc
cgcattggtatcgacagctactccgcattttttgaaaatgaccattgcacgccgacgggc
cttggcggatatttgcgtgaacgcaatatcggatcattgacaatggttggcctcgccacc
gatttctgcgtcgccagttcagcgcttgatgcggtccagcagggctttcaggtgcgggtg
cgactcgatgcctgccgcggtattgatctcaacgggtcgatgaacatcatgctggagaaa
atgaaacaggctggcgtcgaactgatcgatgagcctgtttcagcgtcgcatctactctag

DBGET integrated database retrieval system