KEGG   Brucella melitensis M5-90: BM590_A1772Help
Entry
BM590_A1772       CDS       T01849                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bmg  Brucella melitensis M5-90
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bmg00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bmg00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1727203..1727994
Genome map
AA seq 263 aa AA seqDB search
MTDVSARKTAIVTGSNSGIGLGIAHALAAAGHNVVINSFTDRDEDHALARMLAEEHGANV
IYIAADMSKAEDCRNLIAKTVKVFGNSDILVNNAGIQHVAPVEEFPPEQWDRIIAINLTS
AFHTSAAAIPHMLKAGWGRIINIASAHGLVASPFKSAYVAAKHGIVGFTKTLALELATAK
ITANSICPGYVLTPLVEAQIPDQMKAHHMDRETVIRDVMLDKQPTKEFVTTAQIGAVATF
LASDAAAQINGAAISVDGGWTAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtatccgcccgcaaaactgcaattgttaccggatcaaattcagggatcggc
ctcggaatcgcccatgcactggcagccgcggggcataacgtcgtaataaactccttcacc
gaccgggacgaagaccatgcgcttgcccggatgcttgccgaagaacatggtgcgaatgtc
atctatattgccgcggatatgtcgaaagccgaagattgccgcaatctcattgccaaaacc
gtcaaggttttcggcaactccgatattctggtcaataatgcgggcatccagcatgtcgcc
ccggtggaagagtttcctcccgagcaatgggaccgcatcatcgcaatcaacctgacatcg
gccttccacacttctgctgctgccatcccccatatgctaaaggcgggctggggccgtatc
atcaatattgcctcggcgcatggtctcgtggcttcgccgttcaaatcggcatatgtcgcc
gccaagcacggcattgtcggcttcaccaagacgctggcgctggagcttgccaccgcaaaa
atcaccgccaattccatctgtcccggctatgtgctgacccctctggtggaagcgcagata
cccgaccagatgaaagcccaccacatggaccgtgaaaccgtgatccgcgacgtgatgctg
gataaacagccgacgaaggagtttgtcaccaccgcgcaaatcggggccgttgccactttc
ctcgcaagcgatgcggcagcgcagatcaacggtgcagccatttccgtcgacggcggctgg
acggcagaataa

DBGET integrated database retrieval system