KEGG   Brucella melitensis M5-90: BM590_A1804Help
Entry
BM590_A1804       CDS       T01849                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmg  Brucella melitensis M5-90
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bmg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1759428..1761449
Genome map
AA seq 673 aa AA seqDB search
MFWVHYAMPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFW
AKHGRRIDWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGD
NPYIDKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHS
VVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVL
VVRRTGGKVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTT
GGYLVYASMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPD
QGRFWEVVDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWY
YNVVGDQKCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEC
VADGNLCISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDD
VLNISGHRLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELR
KELVQHVRKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRG
VVDDLIENRQNKK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
ttgttttgggtgcattatgcaatgccggatggttctatttggctgcaaatgctgaaggag
gaaatcatgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatc
gacaacgagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgg
gccaagcacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgat
ttcaacggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataat
tgcatcgaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgac
aacccctatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatg
gcgaatgtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccg
atgatcccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcg
gtcgtctttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatcc
actttcgtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaa
aacaccgataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctg
gtcgtgcgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccat
caggaagtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccg
cttttcattctctacacatccggttccaccggcaagccgaagggtgtgctgcataccacc
ggcggctacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggc
gagatctactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctac
ggaccgctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgat
cagggccgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgcca
accgcgctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcg
acgctgcgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtat
tacaatgtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaat
ggcggcatcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaaca
cgcccgttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagtgc
gtagccgacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctat
ggcgaccacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcg
ggcgatggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgac
gtgctgaatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcg
catcactcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggc
atctattgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgc
aaggaactggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatc
cagtttgcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgc
aagatcgccgaagacgagttcggcgcattgggcgacacctcaacgctcgccgatcggggc
gtggtggacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system