KEGG   Brucella melitensis M5-90: BM590_A1804Help
Entry
BM590_A1804       CDS       T01849                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmg  Brucella melitensis M5-90
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BM590_A1804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BM590_A1804
   00620 Pyruvate metabolism
    BM590_A1804
   00640 Propanoate metabolism
    BM590_A1804
  Energy metabolism
   00680 Methane metabolism
    BM590_A1804
Enzymes [BR:bmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BM590_A1804
Lipid biosynthesis proteins [BR:bmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BM590_A1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1759428..1761449
Genome map
AA seq 673 aa AA seqDB search
MFWVHYAMPDGSIWLQMLKEEIMSEKLYPVLPEAKKNTLIDNETYLEWYEESVSDPDGFW
AKHGRRIDWFKPFTKVKNTDFNGDVTIKWYEDGVTNVSYNCIDRHLKSRGDKVAIIWEGD
NPYIDKKITYRELYENVCRMANVLKKHGVKKGDRVTIYLPMIPEAAYAMLACARIGAVHS
VVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVL
VVRRTGGKVSWGRGRDLWYHQEVASVEPHCEPEPMNAEDPLFILYTSGSTGKPKGVLHTT
GGYLVYASMTHQYVFDYHDGEIYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNFPD
QGRFWEVVDKHHVNIFYTAPTALRALMGAGDEFVTRSSRSTLRLLGSVGEPINPEAWEWY
YNVVGDQKCPIVDTWWQTENGGILITPLPGATDLKPGSATRPFFGVKPVLVDNEGNVQEC
VADGNLCISDSWPGQMRTVYGDHKRFIETYFSTYKGMYFSGDGCRRDEDGYYWITGRVDD
VLNISGHRLGTAEIESALVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTGADAQDPDELR
KELVQHVRKEIGPIATPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRG
VVDDLIENRQNKK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
ttgttttgggtgcattatgcaatgccggatggttctatttggctgcaaatgctgaaggag
gaaatcatgtcggaaaagctttaccccgtgctgccggaggcaaagaaaaacacgctcatc
gacaacgagacttatctcgaatggtatgaggagagcgtgagcgacccggatggcttctgg
gccaagcacggccggcgtatcgactggttcaagcctttcaccaaggtcaagaacaccgat
ttcaacggcgatgtaacgatcaagtggtatgaggatggcgtcaccaacgtctcatataat
tgcatcgaccgccatctgaagagccgcggcgacaaggtcgccatcatctgggaaggcgac
aacccctatatcgacaagaagatcacctatcgcgagctttacgagaatgtctgccgcatg
gcgaatgtgctcaagaagcatggggtgaagaagggcgaccgcgtcacgatctatctgccg
atgatcccggaagccgcctatgccatgctcgcctgcgcgcgcatcggcgccgtgcattcg
gtcgtctttgccggtttctcgccggaggcgctcgctggccgcatcgttgactgcgaatcc
actttcgtcatcaccgccgatgaaggtgtgcgcggcggcaagcctgttgcgctgaaggaa
aacaccgataccgccatcgacatcgccgccaagcaatatgtgatggtcaacaaggtgctg
gtcgtgcgccgcaccggcggcaaggtaagctggggccgcggccgcgatctgtggtaccat
caggaagtcgcaagcgtcgaaccgcattgcgaaccggaaccgatgaatgcggaagacccg
cttttcattctctacacatccggttccaccggcaagccgaagggtgtgctgcataccacc
ggcggctacctcgtctatgcctcgatgacgcatcaatatgtcttcgattaccatgatggc
gagatctactggtgcacggcggatgtgggttgggtaacgggccactcctatatcgtctac
ggaccgctggccaatggcgcgacaacgctgatgtttgaaggcgtgcccaacttccccgat
cagggccgtttctgggaagtcgtcgacaagcaccatgtcaatatcttctacaccgcgcca
accgcgctgcgcgcgcttatgggcgcgggcgatgaattcgtaacccgctcatcgcgttcg
acgctgcgcctgctgggctcggtcggcgagccgatcaatccagaggcctgggagtggtat
tacaatgtcgtgggcgaccagaaatgccccatcgtcgatacctggtggcagacggaaaat
ggcggcatcctcatcaccccacttcccggcgcgaccgatttgaaacccggttcggcaaca
cgcccgttcttcggcgtcaagccggtgctggtggacaatgaaggcaatgtgcaggagtgc
gtagccgacggcaacctgtgcatctccgactcctggccgggccagatgcgcaccgtctat
ggcgaccacaagcgtttcatcgaaacctacttctccacctataaggggatgtatttttcg
ggcgatggctgccgccgcgacgaggacggctattactggatcaccggccgcgtcgatgac
gtgctgaatatttccggccatcgcctcggcacggcggaaatcgaatcggcacttgtctcg
catcactcggtttcggaagccgccgtggtcggctatccgcacccgatcaagggacagggc
atctattgctatgtcacgctgatgaccggcgcagacgcgcaggacccggacgagttgcgc
aaggaactggtccagcatgtgcgcaaggaaatcggccccatcgccacaccggacaagatc
cagtttgcgcccggactgccgaaaacccgttccggcaagatcatgcgccgcatcctgcgc
aagatcgccgaagacgagttcggcgcattgggcgacacctcaacgctcgccgatcggggc
gtggtggacgacctgatcgaaaatcgccagaacaagaaatga

DBGET integrated database retrieval system