KEGG   Brucella melitensis M5-90: BM590_A1909Help
Entry
BM590_A1909       CDS       T01849                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmg  Brucella melitensis M5-90
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BM590_A1909
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BM590_A1909
  Amino acid metabolism
   00310 Lysine degradation
    BM590_A1909
Enzymes [BR:bmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BM590_A1909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1872588..1873814)
Genome map
AA seq 408 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKAGEAIAVDEPLVELETDKVTVEVPAPAAGVLAEIT
AKEGDTVEVGELLGQISSDGAAVAAAPAQKKEEAKPAAAAPAAAPVASASSGPAMQPAPA
AAKLLAESGLSADQVEGSGKRGQVLKGDVLEAITKGVSAAPAAPVAARPASSADDASREE
RVKMTRLRQTIARRLKDAQNTAAMLTTFNEVDMSAVMELRNKYKDVFEKKHGVKLGFMGF
FTKAVTHALKEIPAVNAEIDGTDIVYKNFCHVGMAVGTDKGLVVPVIRDADQMSIAEVEK
ELARLARAARDGSLSMADMQGGTFTITNGGVYGSLMSTPILNAPQSGILGMHKIQERPMV
VGGQIVVRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaattcgcgttcccacgcttggggagtccgttaccgaggcaaccatcgga
aagtggttcaagaaggctggtgaagccattgctgtcgatgagccgctggtggaactggaa
accgacaaggtgacggtcgaagtgcccgcaccggctgcgggtgttctggccgaaatcacg
gccaaagaaggcgatacggtcgaagtgggcgaactgctcggccagatttccagtgacggg
gcagcggttgccgccgcaccggcccagaagaaggaggaagccaagcctgcagccgccgct
cctgctgctgcaccggtcgcatcggcttcgtcgggcccggccatgcagccggcgccggct
gctgcgaagcttctggctgaaagcggtctttccgccgatcaggtcgaaggttccggcaag
cgcggccaggtgctcaaaggtgacgttctcgaggccatcacgaaaggcgtttcggcggct
cctgccgctccggttgccgcgcgtccggcctcctcggctgatgacgcatcgcgcgaagag
cgtgtgaagatgacccgtctgcgccagaccattgcgcgccgcctgaaggatgcccagaac
acggctgccatgctcaccaccttcaacgaggtggacatgtcggcagtcatggagctgcgt
aacaagtataaggacgtctttgaaaagaagcatggcgtgaagcttggcttcatgggcttc
ttcaccaaggcagtgacgcatgcgctgaaggaaatcccggctgtcaacgccgagatcgac
ggcacggacatcgtctacaagaacttctgccatgtcggcatggctgtcggcaccgacaag
ggcctcgtcgttccggtcatccgcgatgccgaccagatgtcgattgcggaagtggaaaag
gaactggcacgtctcgccagggctgcgcgtgacggctcgctttccatggccgatatgcag
ggcggcacctttaccatcaccaatggcggtgtttacggttcgctcatgtccacgccgatc
ctcaatgcgccgcagtcgggcattctcggtatgcacaagatccaggaacgcccgatggtc
gtcggtggccagatcgtggtccgcccgatgatgtatctggcgctttcctacgatcaccgc
atcgtggacggcaaggaagccgtgaccttcctcgtgcgtgtgaaggaaagcctggaagat
ccggaacgtctggttctcgatctctag

DBGET integrated database retrieval system