KEGG   Brucella melitensis M5-90: BM590_B0036Help
Entry
BM590_B0036       CDS       T01849                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmg  Brucella melitensis M5-90
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmg00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmg00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmg00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:30208..31473
Genome map
AA seq 421 aa AA seqDB search
MPVEVVLPALSAGMEDAVIARWLKAEGDAVSKGDLIAEVETDKATMELEAEVDGRIGQLL
VKDGARANVNQVIALLLKEGEDASAMAGFAVGSSPVAVAEAETPVAASPVPAAPAVSAPA
SGEVRHKASPLARRLAAELGVSLDGLAGSGARGRIVRIDVERAAASKPVPVAAAAAPVAA
PAEVSSKAIPVGIGEYEAVPHTSMRRTIARRLLEAKTTVPHFYLNVDCEIDALLALRSQI
NEKREGSARISVNDFVIKASAAALRRVPDANVIWTDEALLKLKDVDIAVAVATEGGLITP
IIRSADQMSLGAISAQMKSLAARARENRLKPEEFQGGGFSISNLSMYGVKSFSAIINPPQ
SAILAVGAGERRPIERNGELAFATMMSVTLSVDHRAVDGALGAQLLAAFKAGIEDPMSLL
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcgtattgcctgccctttcggcaggaatggaagatgcagtcatcgcg
cgctggctcaaggccgaaggcgacgcggtgagcaagggcgacctgatcgccgaagtcgaa
accgacaaggcgacgatggagcttgaagccgaagtggatggccgcattggccagcttctg
gtgaaggacggtgcgcgcgccaatgtcaatcaggtgatcgccctgcttttgaaggaaggc
gaagatgcttctgcaatggccggatttgcggtcggctccagtcctgtggccgtggcagaa
gccgaaacccctgttgcagcctcgccggtgccagccgcaccagcagtaagcgcgcccgcc
tccggtgaagtgcgccacaaggcttcgccgctcgcccgccgcctggctgcggaactgggc
gtttcgctggacgggcttgcgggaagtggcgcaaggggccgtatcgtacggatcgacgtg
gaacgcgcggccgcctcgaagccggttccggttgccgccgctgccgctccagtcgccgca
cctgcggaagtttcgtcgaaagccattccggttggcatcggcgagtatgaagccgttccg
cacacatccatgcgccgcaccattgcccgccgcctgctggaagccaagacaacggtgccg
catttctatctgaacgtggattgcgagatcgatgcgcttctggcattgcgcagccagatc
aacgagaagcgggaaggttcggcccgtatttccgtcaatgattttgtcatcaaggcttcc
gccgccgccctgcgccgggtgcccgatgccaatgtcatatggacagacgaggcgcttttg
aagctgaaggacgtcgatattgccgttgcggtggcgacggaaggcggccttatcacaccg
attattcgcagtgccgaccagatgagccttggcgctatttcggcgcagatgaagtctctg
gccgcgcgtgcccgcgaaaaccgcctgaagccggaagaattccagggcggtggcttttcg
atttccaatctcagcatgtatggtgtcaaatccttttcggccatcatcaatccgccgcaa
agcgccattctggcggttggcgcgggcgaacgccgcccaatcgaacgcaatggtgagctt
gctttcgccaccatgatgagcgtgacgctttcggttgaccatcgcgcggtcgacggcgcc
ctgggtgcgcaactgctcgcggccttcaaggccggtattgaagatccgatgtctctgctt
gtctag

DBGET integrated database retrieval system