KEGG   Brucella melitensis M5-90: BM590_B0073Help
Entry
BM590_B0073       CDS       T01849                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmg  Brucella melitensis M5-90
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BM590_B0073 (galU)
   00052 Galactose metabolism
    BM590_B0073 (galU)
   00500 Starch and sucrose metabolism
    BM590_B0073 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BM590_B0073 (galU)
Enzymes [BR:bmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BM590_B0073 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:69392..70285
Genome map
AA seq 297 aa AA seqDB search
MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDEAREAGIEHLIFVT
GRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSFTRQQVPLGLGHAVWC
ARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAVQECDPEEAHKYGIVGKG
GAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLLSKQEKGAGNEIQLTDAMLK
LADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDIRPSVEGSIGHLLKTIQPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttctattcggaaaatccgcaaggcagtctttcccgtcgcaggtcttggaacgcgc
ttcctgcccgcaaccaaatccatcccgaaggaaatgctgacggttgttgacaaacccgtc
atccaatatgtcgtggacgaagcgcgcgaggcgggtattgaacacctgattttcgttacg
gggcgcaacaaggctgtcatcgaggattatttcgatgcgcaggtggagctttattccaca
ctggccgaacgggggaaaaccgaagagttgaaccgcctgcaggatttgcagccgcagccg
ggcaccaccagctttacccgccagcaggtgccgcttggcctcggccacgctgtctggtgt
gcgcgggaactggtgggcaacgaaccttttgcactgcttctgcctgatatggtgatgcag
tcgaaaaagggctgccttgccgaaatggtcgaactttacgaacagaccggcggcaatatc
atcgccgtgcaggaatgcgacccggaagaggcgcataaatacggtatcgtgggcaagggc
ggcgctgtcggcaatggcttcgagattacgcgcatggtcgaaaagccggctaagggcacg
gcgccgtccaatctctatatcaatgggcgctatatcctccagccggagattttcgggctg
ttgagcaagcaggaaaagggtgcgggcaacgaaatccagctgaccgatgccatgctgaag
cttgccgaccagcagaagttctatggcttcgattatcgcgggctgaccttcgattgcggc
tcgaaggcaggcttcattgaggccaatgtggctttcgcactatggcgtgaggatatccgc
ccgtccgtggaaggctccatcggccatctgttgaagacgatccagccagcctga

DBGET integrated database retrieval system