KEGG   Brucella melitensis M5-90: BM590_B0268Help
Entry
BM590_B0268       CDS       T01849                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmg  Brucella melitensis M5-90
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bmg00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:258692..259792
Genome map
AA seq 366 aa AA seqDB search
MSSEQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPD
GIHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTT
LFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNK
FSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSFWSRED
PFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTN
IDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAMHMEMQGRML
VEPKKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgagcaggactggattgtcgtcttcaacctgaagcgtatcgaagaagccgtc
gccaatggcgatttcaaggaaatgaacggtgtgccggtcatcgacggtcgccacggctcc
aaatatacgcgctatattccggtgccgaacagcccgcacggtatcaacaccgcgccggac
ggcatccatgtggtcgccaatggcaagctgtcgccgaccgtgacggtgttcgatgtgcgc
aagttcgacgacctgttcgacgacaagatcaagccgcgcgacgctgttgtggccgagccg
gaactggggcttggaccattgcacacggcctatgatgacaagggcaacgcctatacgacg
ctcttcatcgacagccagatctgcaaatggaacattgaagacgccaagcgcgcattcaag
ggcgaaaaggtcgatccgatccgtcagaagctcgacgttcattatcagccgggccacaat
cacagctccatgggccaaaccaaggaagttgatggcaagtggctgatttcgctgaacaag
ttctccaaggaccgttacctcaatgtcggtccgctcaagcctgagaacgaccagctcatc
gatatttccggcgataagatggtgattgttcacgacggtccgagctttgcggaaccgcat
gatgcaacgatcgttcaccgctccaagatcaaccctgtcagcttctggagccgtgaggat
ccattttttgccgatgccgtggcgcaggcaaaggcggacggtcttgatctgatggaagcc
aatgaagtggtgcgtgacggcaacaaggtgcgtgtctatatgacgtcttccgcgcctgcc
ttcggcctcaccgaattcactgtccagcaggatgatgaagtgacggtttatgtcaccaat
atcgatgagatcgaagacctgacccatggtttcgctatcgtcaattacggtgtgaacatg
gaagtcgcaccgcaggcgacggcttcggtcacgttcaaggcctccaagccgggtgtgtgg
tggtattactgctcgtggttctgccacgccatgcatatggaaatgcagggccgtatgctc
gtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system