KEGG   Brucella melitensis M5-90: BM590_B0268Help
Entry
BM590_B0268       CDS       T01849                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bmg  Brucella melitensis M5-90
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BM590_B0268
Enzymes [BR:bmg01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BM590_B0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:258692..259792
Genome map
AA seq 366 aa AA seqDB search
MSSEQDWIVVFNLKRIEEAVANGDFKEMNGVPVIDGRHGSKYTRYIPVPNSPHGINTAPD
GIHVVANGKLSPTVTVFDVRKFDDLFDDKIKPRDAVVAEPELGLGPLHTAYDDKGNAYTT
LFIDSQICKWNIEDAKRAFKGEKVDPIRQKLDVHYQPGHNHSSMGQTKEVDGKWLISLNK
FSKDRYLNVGPLKPENDQLIDISGDKMVIVHDGPSFAEPHDATIVHRSKINPVSFWSRED
PFFADAVAQAKADGLDLMEANEVVRDGNKVRVYMTSSAPAFGLTEFTVQQDDEVTVYVTN
IDEIEDLTHGFAIVNYGVNMEVAPQATASVTFKASKPGVWWYYCSWFCHAMHMEMQGRML
VEPKKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgagcaggactggattgtcgtcttcaacctgaagcgtatcgaagaagccgtc
gccaatggcgatttcaaggaaatgaacggtgtgccggtcatcgacggtcgccacggctcc
aaatatacgcgctatattccggtgccgaacagcccgcacggtatcaacaccgcgccggac
ggcatccatgtggtcgccaatggcaagctgtcgccgaccgtgacggtgttcgatgtgcgc
aagttcgacgacctgttcgacgacaagatcaagccgcgcgacgctgttgtggccgagccg
gaactggggcttggaccattgcacacggcctatgatgacaagggcaacgcctatacgacg
ctcttcatcgacagccagatctgcaaatggaacattgaagacgccaagcgcgcattcaag
ggcgaaaaggtcgatccgatccgtcagaagctcgacgttcattatcagccgggccacaat
cacagctccatgggccaaaccaaggaagttgatggcaagtggctgatttcgctgaacaag
ttctccaaggaccgttacctcaatgtcggtccgctcaagcctgagaacgaccagctcatc
gatatttccggcgataagatggtgattgttcacgacggtccgagctttgcggaaccgcat
gatgcaacgatcgttcaccgctccaagatcaaccctgtcagcttctggagccgtgaggat
ccattttttgccgatgccgtggcgcaggcaaaggcggacggtcttgatctgatggaagcc
aatgaagtggtgcgtgacggcaacaaggtgcgtgtctatatgacgtcttccgcgcctgcc
ttcggcctcaccgaattcactgtccagcaggatgatgaagtgacggtttatgtcaccaat
atcgatgagatcgaagacctgacccatggtttcgctatcgtcaattacggtgtgaacatg
gaagtcgcaccgcaggcgacggcttcggtcacgttcaaggcctccaagccgggtgtgtgg
tggtattactgctcgtggttctgccacgccatgcatatggaaatgcagggccgtatgctc
gtcgaaccgaaaaaggcctga

DBGET integrated database retrieval system