KEGG   Brucella melitensis M5-90: BM590_B0330Help
Entry
BM590_B0330       CDS       T01849                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bmg  Brucella melitensis M5-90
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bmg00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmg00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bmg00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:321116..321511
Genome map
AA seq 131 aa AA seqDB search
MEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMTMEGLYT
ALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAVADSLGH
NLYTTRGKVSS
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtggatatttatacgcgccaatgttcaacgcttgtaaccgcgaccgacctt
gccacgatgggggcaacccttgccgccggcggtgttaatccgatcagcgggaagcgcatg
gtttcggcaggcaatgttgccccaattctggccgaaatgaccatggaaggcctttatacg
gctttaggcgattgggcttatacggtcggcctacccggtaaaagcggtgtcggtggtggc
atcatggcggtagtgccgggtgagctggcaattgccgcgttttcaccgccgcttgatcca
gccggaaatagtgtgaaagcaatggctgctgttgccgcagtggcagattcacttggccat
aatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system