KEGG   Brucella melitensis M5-90: BM590_B0417Help
Entry
BM590_B0417       CDS       T01849                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bmg  Brucella melitensis M5-90
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BM590_B0417 (glpK)
Enzymes [BR:bmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BM590_B0417 (glpK)
Exosome [BR:bmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BM590_B0417 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(411586..412656)
Genome map
AA seq 356 aa AA seqDB search
MLNHVPGLRERAQKGQVCFGTIDSWLIYKLTGGKAHVTDATNASRTLIYHIGENRWDDEL
LDILGIPAAMLPEVKDCAADFGMTDPALFGVSIPILGVAGDQQAAVIGNACFEPGMMKST
YGTGCFALLNTGTDRVTSSNRLLTTIAYRLDGVTTYALEGSIFIAGAAVQWLRDEMGFIS
VASEVSALAEKADPNQRIYLVPAFTGLGAPYWDAEARGAIFGLTRGTGRAEFARAALESV
AYQTFDLLEAMQGDWKGATNHTVLRVDGGMVASDWTMQRLADILNAPVDRPVFLETTVLG
AAWLAASRAGIWPDRKGFSERWQRDCRFEPAMPEKERESAIAGWRDSVSRCLTRPQ
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaaccatgttccgggcctgcgcgagcgtgcgcaaaaaggtcaagtctgcttcggc
accatcgatagctggctgatctacaagctcaccggcggcaaggcgcatgtaaccgacgcc
acaaatgcctcgcgtacattgatctatcatatcggcgaaaaccgttgggatgatgaactg
ctggacatattgggcattccagccgccatgctgccggaagtgaaggactgcgcggcggat
ttcggcatgacggaccctgcccttttcggcgtttccattcctattctcggcgtagcgggc
gaccagcaggcggcagtgatcggcaatgcctgcttcgagccaggcatgatgaaatccacc
tacggcaccggatgttttgcacttctcaacaccggcacggatcgcgtcacctcctccaac
cggctgctcaccaccatcgcctaccggctcgacggtgttacgacctatgcgctggaaggt
tcgatattcatcgcgggcgcggccgtacaatggcttcgtgacgaaatgggcttcatttcg
gtcgcatcggaagtaagcgcgctggccgaaaaggccgacccgaaccagcgcatctatctg
gttccagccttcaccgggcttggcgcaccctattgggacgccgaagcgcgcggcgcaatc
ttcgggttgacgcgcgggacgggccgcgcagaatttgcccgcgcagcacttgaaagcgtg
gcctatcagaccttcgaccttctggaagccatgcaaggggactggaaaggtgcaaccaat
cacacggtgctgcgcgtcgatggaggcatggttgcttccgactggaccatgcagcgactg
gccgacattctgaacgcacccgtcgatcgcccggtttttcttgaaaccaccgtgctgggc
gccgcatggctggccgcctcccgcgcaggcatctggccggatcgcaagggtttttcggaa
cgctggcagcgtgattgcaggtttgagccggctatgccggaaaaagaacgtgaaagcgcg
attgcgggctggcgggatagcgtttcacgctgcctaacacgaccgcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system