KEGG   Bacillus megaterium WSH-002: BMWSH_0090Help
Entry
BMWSH_0090        CDS       T01890                                 

Definition
Agmatinase (Agmatine ureohydrolase)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMWSH_0090
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BMWSH_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91771..92649
Genome map
AA seq 292 aa AA seqDB search
MRFDEAYSGNVFIGSHPVFEESEAVLYGMPMDWTVSYRPGSRFGPTRIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNPQRSLNMIEEYIDQLLAADKFPLGMGGEHLVSWPVMK
AMYKKYPDLAIIHMDAHTDLREEYEGEPLSHSTPIRKVAELIGPENVYSFGIRSGMKEEF
QWAKENGMHISKFEVLEPLKEILPTLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLASIHAIAKSDLRIVGGDLVEVAPIYDPSEQTANTASKLIREMILGWVQKK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaatgtatttatcggcagtcaccctgtttttgaa
gaaagtgaagcggttctttacggaatgccaatggactggacagttagctatcgtccaggt
tcacgatttggcccaactcgtattcgtgaagtatcaattggattagaagaatacagcccg
tatttagatcgcgagctagaggaagtaaaatattttgatgcaggagatattccacttcca
tttggaaatccgcagcgcagcttaaatatgattgaagagtatatcgaccagcttttagca
gcagacaagttcccgttaggtatgggcggagagcatttggtttcttggcctgttatgaaa
gctatgtataaaaaatatcctgatttagccattatccatatggatgctcacacagacctt
cgtgaagagtatgaaggagaaccactttctcattccactccaattcgtaaagttgctgaa
ctaatcggaccggagaatgtttattcatttggtattcgttcaggaatgaaagaagaattt
caatgggcaaaagaaaacggcatgcatatttcaaagtttgaagttttagagccgttaaaa
gagattctaccaacacttgcaggtcgccctgtttatgtaacaattgatatcgatgtatta
gatccagcacacgctcctggtacaggaacagtagatgcaggcggtatcacatcaaaggag
cttttagcttctattcacgcaattgctaaatcagatcttcgcattgtcggaggagattta
gtagaagtagctccaatttatgatccgtctgaacaaacagctaatacagcaagcaagctt
attcgcgaaatgatcttaggctgggtacaaaagaaataa

DBGET integrated database retrieval system