KEGG   Bacillus megaterium WSH-002: BMWSH_0108Help
Entry
BMWSH_0108        CDS       T01890                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMWSH_0108 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BMWSH_0108 (murA2)
Enzymes [BR:bmh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BMWSH_0108 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113860..115146
Genome map
AA seq 428 aa AA seqDB search
MEKLKIQGGFTLSGSVRVSGAKNSAVALIPATILAESPVTIEGLPDISDVQLLGDLVEEI
GGKVTIDNDELTVDPSGMVAMPLPNGKVKKLRASYYLMGAMLGRFKKAVVGLPGGCYLGP
RPIDQHIKGFEALGAKVTNEQGAIYIRAEELIGARIYLDVVSVGATINIMLAAVRAKGRT
VIENAAKEPEIIDVATLLTSMGARIKGAGTDVIRIDGVDQLKGCRHSIIPDRIEAGTYMI
MGASMGKEVVVDNVIPQHLESLTAKMREMGIHIETSSDQILVATRQLLKPVDIKTLVYPG
FPTDLQQPFTTLLTRASGTSVVTDTIYGARFKHIDELRRMNASVKVEGRSAIINGPIHLQ
GARVKASDLRAGAALVTAGLMAKGITEVTGLEHIDRGYSHLVDKLSELGAMIWREEMTQE
EIEQFQNS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttaaaaatacaaggtggctttaccttaagtggatccgtccgcgtcagtggt
gctaaaaatagtgccgttgcgcttattccagcaacaattttagccgagtcacctgttaca
attgaaggtctgcccgatatttcagacgtgcagttattaggggatttagttgaagaaatt
ggtgggaaagtaaccattgataacgacgaattaacagtagatccatccggaatggttgca
atgcctttaccgaacggaaaagtaaaaaaattacgcgcttcttattatttaatgggggcg
atgttaggacgctttaaaaaagcggtagttgggcttccaggaggctgttatcttggtcct
agaccaatcgatcagcacattaaaggctttgaagctcttggcgctaaagtaacaaatgag
caaggagctatttacattcgagctgaggaactgattggtgctcgaatttatttagacgtt
gttagcgtaggagcaacaatcaatattatgctcgctgctgtaagagcaaaagggcgtacc
gttattgagaatgctgctaaagagcctgaaattattgatgtagctacgttactgacaagt
atgggtgcccgtattaaaggtgcaggtacggatgttattcgaattgatggagtagatcaa
ttaaaaggatgccgtcattccatcattccagaccgaattgaagcaggcacatatatgatc
atgggagcgagtatgggaaaagaagttgttgtcgacaacgttatccctcagcatttggag
tcattaacggctaaaatgcgtgagatgggtattcatatcgaaacaagctcagatcagatt
cttgtagcgactcgtcagctattgaagcccgtagatattaagacgctagtatatccaggt
tttccaactgatttacagcaaccatttacgacgcttctaacaagagcgtctggtacaagc
gttgtgacggatacaatttacggtgcaaggtttaagcatattgatgagctgagacgaatg
aatgcatctgttaaggtagaaggacgttctgctattattaatggtcccattcacttacaa
ggtgcgcgtgtgaaagcgtcggacttacgagcaggagcagctctcgtaaccgctggctta
atggccaaagggattacagaggtaacgggtttagagcacattgaccgaggttacagtcat
ttagtagacaagctatcggagttaggggcaatgatttggcgtgaagagatgactcaagag
gaaattgagcaatttcaaaattcatag

DBGET integrated database retrieval system