KEGG   Bacillus megaterium WSH-002: BMWSH_0148Help
Entry
BMWSH_0148        CDS       T01890                                 

Gene name
galU
Definition
(GenBank) Utp-glucose-1-phosphate uridylyltransferase, (Pxo1-94)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00040  Pentose and glucuronate interconversions
bmh00052  Galactose metabolism
bmh00500  Starch and sucrose metabolism
bmh00520  Amino sugar and nucleotide sugar metabolism
bmh01100  Metabolic pathways
bmh01130  Biosynthesis of antibiotics
Module
bmh_M00362  Nucleotide sugar biosynthesis, prokaryotes
bmh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMWSH_0148 (galU)
   00052 Galactose metabolism
    BMWSH_0148 (galU)
   00500 Starch and sucrose metabolism
    BMWSH_0148 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BMWSH_0148 (galU)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMWSH_0148 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEN87032
UniProt: G2RSF0
Position
155606..156490
Genome map
AA seq 294 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVASGIEDILIVSGRGK
RAIEDHFDKSYELEETLAAKEKWDMLEEVQGISNLANVHYIRQKEPKGLGHAIHCARSFI
GDEPFAVMLGDDVVQSETPCLKQLMDVYEKYECAVVGVQEVPRKETSKYGIVGPKGEPLE
KGLLDVETLVEKPNPEDAPSGYAIMGRYILTPEIFDILSREEIGAGGEIQLTDAILRLNE
FQRVLAYYFEGKRYDVGDKFGFIKATIDLALQREPLRAELVSYFREIVEKEGHM
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattcgtaaagctattattccagcagctggattagggacacgctttttgccggct
acaaaagcacagcctaaagaaatgctgccaattgtagataaaccaacgattcaatacatt
gtggaagaagcagtagcatcaggtattgaagacattttaattgtaagcggtcgcggaaaa
cgagcaatcgaggatcattttgataaatcatatgagttagaagaaacattagccgcaaag
gaaaagtgggacatgcttgaagaagtgcaggggatttcgaatttggctaatgttcactac
attcgtcaaaaggaacctaaaggattaggtcatgccattcactgtgcaagaagttttatc
ggagatgaaccgtttgctgttatgctaggggatgatgtagtccaatcagaaacaccttgt
ttgaaacagttaatggacgtatacgaaaaatatgaatgcgctgtagttggtgtacaggag
gtgcctaggaaagaaacctcaaagtacggaattgtaggtcctaaaggagagcctcttgaa
aaaggattattagacgtagaaacgctcgttgaaaaaccgaatccagaagatgccccttca
ggctatgcaattatggggcgctatattttaacaccggaaattttcgatatcttaagcaga
gaagagattggtgcaggaggagaaattcaattaacagatgctattttacgtctgaatgaa
tttcaacgtgttcttgcttattatttcgaaggaaaacgttatgatgttggagataaattt
ggattcattaaagcaaccattgatttagctctgcaaagagaaccgctgcgagcagagcta
gtgagctattttagagaaattgtcgaaaaagaagggcatatgtaa

DBGET integrated database retrieval system