KEGG   Bacillus megaterium WSH-002: BMWSH_0206Help
Entry
BMWSH_0206        CDS       T01890                                 

Gene name
hisD
Definition
Histidinol dehydrogenase 2
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bmh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218484..219530
Genome map
AA seq 348 aa AA seqDB search
MLSIIREAADNIRDYHERMVEQSWMTTKEDGTILGQKVTPLDAVGVYVPGGLAAYPSSVL
MNVIPAQVAGVKRIVMVSPPGKDGALPAGVVVAANELGVEEIYKVGGAQAVGALAYGTET
IKPVDKIVGPGNIFVALAKREVYGLVDIDSIAGPSEIVVLADETAKPNEVAADLLSQAEH
DNLASSILVTSSMKLAEAVKEEVERQVESLPRKEIAKPSIDNHGAIYVTGSLEEAVEAVN
QLAPEHLEIMTESPLELLGSIRHAGAIFLGRYSSEPVGDYFAGPNHVLPTNGTAKFSSPL
SVDSFVKKSSIISYSQQALQKNVSKIAAFARLEGLEAHARAVEERFKK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcaatcattcgcgaagctgctgacaacattcgtgattaccacgaaagaatggtc
gagcagtcttggatgacaacaaaagaagacggcaccattttaggtcagaaagtaacgcct
ttagatgcagtaggtgtttatgtaccgggaggccttgcggcttatccttcttccgtttta
atgaatgttattcctgctcaagtggcaggggtaaaacgtattgtgatggtttcacctcca
ggaaaagacggcgcgctgcctgctggagtagttgtagcagcgaatgagcttggggtcgaa
gagatttataaagtagggggagctcaagcggtaggagcacttgcctatggaacagaaaca
attaaacctgttgataaaattgtagggcctggtaatatctttgttgcattagcgaaaaga
gaagtatatggattagtagacattgactcaattgctggacctagtgaaattgtcgtacta
gcagacgaaacggctaagcccaacgaagtggcagctgatttattgtctcaagcagaacat
gacaacttagcttcaagcattttagtaacatcttctatgaaattagccgaagctgttaaa
gaagaagtggaaagacaagtggaatctttacctcgtaaagaaatcgccaaaccttctatt
gataaccatggtgctatttatgtgaccgggtcattagaagaagcggttgaagctgttaat
caattagcccctgagcatttagaaattatgactgaaagtccgcttgaacttttaggttcc
attcgtcatgccggtgctatttttctaggaagatacagctcagaacctgttggggattat
ttcgcgggaccaaaccacgttcttccaacaaatgggacagcaaaattctcaagtccttta
tcagttgattcatttgtgaagaagtctagtatcatttcatacagccaacaagccctgcag
aaaaatgtctcgaaaatcgcagcgtttgctcgtttagaagggctagaagctcatgcaagg
gcggttgaagaacgctttaaaaaataa

DBGET integrated database retrieval system