KEGG   Bacillus megaterium WSH-002: BMWSH_0226Help
Entry
BMWSH_0226        CDS       T01890                                 

Gene name
tpiA
Definition
Triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_0226 (tpiA)
   01230 Biosynthesis of amino acids
    BMWSH_0226 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_0226 (tpiA)
   00051 Fructose and mannose metabolism
    BMWSH_0226 (tpiA)
   00562 Inositol phosphate metabolism
    BMWSH_0226 (tpiA)
Enzymes [BR:bmh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMWSH_0226 (tpiA)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMWSH_0226 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMWSH_0226 (tpiA)
  Exosomal proteins of melanoma cells
   BMWSH_0226 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237161..237916
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKVLSEATSFVEEVKGAVPSPESVDSVVCAPALFLDRLVEATKGTDLK
IGAQNMHFEENGAFTGEVSPVALADLGVNYVILGHSERREMFAETDETVNQKTIAAFKHG
LTPIVCCGETNEEYEQDQTKTVVANQVQKALAGLTDEQVKQTVIAYEPIWAIGTGKSSTA
EGANEVCAYIRSVVAEQFSQDVADAVRIQYGGSVKPANIKEYMSQSDIDGALVGGASLEA
DSFLQLLEAGK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggaaactggaaaatgaacaaagtactttctgaagcaact
agctttgttgaagaagtaaagggagcagtaccatctcctgaaagcgtagattcagtagta
tgtgcacctgcactatttttagatcgtttagtagaagcgactaaaggcacagacttaaaa
attggtgcacaaaacatgcactttgaagaaaacggtgcgttcactggagaagtgagccct
gttgctttagcagatttaggcgtgaactatgttattttaggacactctgagcgtcgtgaa
atgtttgctgaaacggacgaaacagtaaaccaaaaaacaattgctgcattcaaacacggt
ttaacaccaattgtttgctgcggtgaaacaaacgaagaatacgaacaagaccaaacaaaa
acagttgtagctaatcaagtacaaaaagcattagcgggtctaactgatgagcaagtaaaa
caaacggttatcgcatatgagccaatttgggcaatcggtacaggtaaatcttcaactgct
gaaggtgcaaacgaagtttgtgcatacatccgtagcgttgttgcagaacaattctctcaa
gatgttgcagatgctgtacgtattcaatacggcggtagcgtaaaacctgctaatattaaa
gaatatatgtctcaatcagacattgacggagctttagtaggtggagcaagcttagaagca
gattctttcttacagcttttggaggctggtaagtaa

DBGET integrated database retrieval system