KEGG   Bacillus megaterium WSH-002: BMWSH_0230Help
Entry
BMWSH_0230        CDS       T01890                                 

Definition
thermostable carboxylesterase Est30
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bmh  Bacillus megaterium WSH-002
Brite
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BMWSH_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241478..242218
Genome map
AA seq 246 aa AA seqDB search
MKIAQPKPFTFEGGEKAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPHYKGHGVAPEEL
VHTGPEDWWKDVIEGYEFLKSKGHESIAAVGLSLGGVFSLKLGYTVPIKGIVPMCAPMYI
KSEEVMYEGVLAYAREYKKREGKSSEQIEQEMEEFKQTPMNTLKSLQELIAEVRNSVDMI
YAPTFVVQGRHDHMINTDSANIIYNSVESPTKDIKWYEESGHTITFDKERDQLHEDVYAF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcacaaccaaagccatttacatttgaaggcggcgaaaaagctgttttatta
cttcacggttttaccggaaactctgctgatgttcgcatgttaggtcggtttttagagaaa
aaaggatacacatgccacgcacctcattacaaaggacacggtgtagcgcctgaagagctt
gttcatactggtccggaggattggtggaaagatgtcatagaaggctatgagtttttaaaa
agtaaaggtcatgaaagtattgctgctgtaggtctttcactaggtggcgtattttcactg
aaattaggttacactgtacctataaagggtattgtgcctatgtgcgcgcctatgtatata
aagagtgaagaagtcatgtatgaaggtgttttagcttatgcacgcgaatataaaaagcgt
gaaggtaaatcgtctgaacagattgaacaggaaatggaagagttcaaacaaacaccaatg
aacacattaaagtctttacaggaattaatcgctgaggtgcgaaattcagttgatatgatt
tatgcaccgacatttgttgtacaaggtcgtcatgatcatatgattaatacagacagcgcc
aatattatttataatagcgtcgagtctcctacaaaagatattaaatggtacgaagagtct
ggtcataccattacctttgataaagagcgtgatcagcttcatgaggatgtatatgcattt
ttggaatcacttgattggtaa

DBGET integrated database retrieval system