KEGG   Bacillus megaterium WSH-002: BMWSH_0300Help
Entry
BMWSH_0300        CDS       T01890                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMWSH_0300
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMWSH_0300
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMWSH_0300
Enzymes [BR:bmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMWSH_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311288..312352
Genome map
AA seq 354 aa AA seqDB search
MMWKGLLAEYKEFLPVTEKTPMLTLHEGNTPLIHLAHLSKELGIDLHVKVEGLNPTGSFK
DRGMVMAVAKAKEEGSNTVICASTGNTSAAAAAYASRAGMRCIVVIPNGKIAMGKLAQAV
MYGAEIVAIEGNFDQALSMVRKLSETSPVALVNSVNPYRIEGQKTASFEICEQLGKAPDV
LAIPVGNAGNITAYWKGFKEYSERHQTSLPHMHGFEAEGAAAIVRNQVIENPETIATAIR
IGNPASWDYAVNAAKESNGKIDEVTDEQILEAYRTIARKEGVFAEPGSCASIAGVFKDVA
SGKIAKGSTVVAVLTGNGLKDPNVAIDAHNVKPVVLPNDEEKVFEYIQGVVASC
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaaaggtctattagctgaatataaagaatttttacctgtaacagagaaaaca
cctatgcttacactacatgaaggaaatacgcctttaattcatcttgctcatttatcaaaa
gagctaggcattgacttacatgtaaaagtagaagggctaaatccaacggggtcatttaaa
gaccgcggaatggtaatggctgtagccaaagcaaaagaagaaggaagcaatacggttatt
tgtgcatccacaggtaacacatctgcagctgcagcagcttatgcatcacgcgctggcatg
cgctgtatcgttgttattccaaatggaaaaattgcgatggggaaattagctcaagctgtt
atgtatggtgcagaaattgtagcaattgaaggaaactttgaccaagcgctttctatggtt
cgtaagctaagtgaaacatcacctgttgcacttgtaaactctgtaaacccataccgtatt
gaagggcaaaaaacagcttctttcgaaatttgtgaacagcttggaaaagcgcctgatgtt
ttagctattccggtagggaacgcagggaacattacagcttactggaaaggattcaaagag
tacagtgagcgtcatcaaacgtctcttcctcacatgcatggttttgaagcagaaggtgca
gcggcgatcgtacgtaaccaagttatcgaaaacccagaaacaattgcaacggctattcga
atcggaaatccagcaagctgggattatgctgtaaacgcagcaaaagaatcaaacggaaaa
attgatgaagtaacagatgaacaaatcttagaagcatatcgtacaattgcacgcaaagaa
ggcgtatttgcagagccaggttcttgcgcttcaattgctggtgtattcaaagatgtagct
tctggtaaaattgcaaaaggttcaacggtagtagctgtactaacaggtaacggattaaaa
gatccaaacgtagcaatcgatgctcataatgtaaagccagtagttttaccaaatgatgaa
gaaaaagtatttgagtatatccaaggtgtcgttgcttcatgctag

DBGET integrated database retrieval system