KEGG   Bacillus megaterium WSH-002: BMWSH_0349Help
Entry
BMWSH_0349        CDS       T01890                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme / Glucose-1-phosphate adenylyltransferase catalytic subunit
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMWSH_0349 (glgB)
Enzymes [BR:bmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BMWSH_0349 (glgB)
Exosome [BR:bmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMWSH_0349 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363499..365460
Genome map
AA seq 653 aa AA seqDB search
MFEVKGVAKVNLAVQPTEFDVHLYHEGNLFRSYSIFGAHQVTVEGIEGVRFCVWAPHAKG
VSVVGDFNKWNGFQHSMVKVNEEGIWMTFIPELEQGTIYKYEIITQSNQKKLKADPYAFF
SEVRPNTASIVYSLDGYKWNDQYWRRKKKQQNIYERPLCIYELHAGSWRTHEDGSLYTYS
ELAQELIPYIAEQGFTHIELLPVIEHPLDRSWGYQGTGYYSATSRYGTPKELMNFIDECH
QNNIGVLLDWVPGHFCKDEHGLYMFDGEPTYEYKKEPDRENYVWGTANFDLGKPEVQSFL
ISNALFWLEYFHIDGFRVDAVANMLYWQNSSGKAVNDGAVSFLKKLNEAVFKSDETILMM
AEDSTDWPLVTAPTYEGGLGFNYKWNMGWMNDVLTYMEAGVERRPYLHDKMTFSLMYAFN
ENFILPLSHDEVVHGKKSLLNKMPGDYWRKFAQLRLLYGYFFAHPGKKLLFMGGEFGQFD
EWKDLEELDWMLYDFDMHRNLNGYMKDLIKIYKRSKPLYELDHNPDGFEWIDVNNHHQQI
FSFIRKSKENQEIFIVVSNFSEHPYHSYKVGVPVETEYIEVINSDDEVYGGSGTVNKKAL
KSVDESFHGQPFCIEMNIPPFGISILRAKRKRGERKQHVKKEMRSDVIGRRKR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagttaaaggggtggcaaaagtgaatctagcggttcagcctactgaatttgat
gttcatttgtatcacgaaggaaacttatttcgcagttactctattttcggtgcgcatcag
gtaacggtagaaggaattgaaggcgtacgattttgcgtgtgggcacctcatgcaaagggt
gtaagcgttgtaggtgattttaataaatggaacggttttcaacattcaatggttaaagtt
aatgaagaaggtatttggatgacatttatccctgaattagaacaagggactatttataaa
tatgaaatcatcacacaaagcaatcaaaaaaaattaaaagcagatccatacgctttcttc
agtgaagtgcgtccaaacactgcttctattgtttactcattggatgggtacaaatggaac
gaccaatattggcgtagaaagaaaaaacagcaaaatatatatgaaagaccactgtgtatt
tacgagctgcatgcagggtcttggaggactcatgaagatggcagcctttatacatacagt
gaattagcacaggagcttattccttatattgctgaacaaggttttacacatattgagtta
ttaccagtcattgagcatccgctcgaccgatcctggggatatcaaggaactggatactat
tctgctaccagtcgatacggtacacctaaagagttgatgaactttatagatgagtgtcat
caaaataatataggcgttcttttagactgggtacccgggcatttttgtaaggatgaacat
ggtctgtatatgtttgatggagaacctacttatgaatacaaaaaagaacccgaccgtgaa
aactatgtttggggaacagctaatttcgatttaggcaagcctgaagtacaaagttttctc
atttcgaacgctttgttttggttggagtacttccacatagatggatttcgagtagatgct
gtagctaatatgctttattggcaaaattcttctggaaaagcagtaaatgatggagctgtc
agcttcttaaaaaaattgaatgaagctgtttttaaatctgatgaaacgatattaatgatg
gcagaagattcaacagattggccccttgttacagcacctacgtatgagggcggtttaggc
tttaattataagtggaacatgggatggatgaatgacgttttaacgtacatggaagctggc
gtggaaagacgtccctatcttcacgataaaatgaccttttcactaatgtatgcgtttaac
gaaaactttattttgccgctttctcatgatgaagtcgtacatgggaaaaaatcattgctt
aataagatgccaggtgattactggcgcaagtttgcacagcttcgactgctatatggatat
ttctttgcacaccctggaaaaaagcttttatttatgggcggagagtttggccaatttgat
gagtggaaagatttagaagagttagactggatgctttatgactttgacatgcatcgcaat
cttaacggatatatgaaggatctcatcaagatttataaaagaagcaagcctttatacgaa
ttagaccataatccagatggatttgaatggattgatgttaacaatcatcatcaacaaatt
ttctcctttattcgcaagtcgaaagaaaatcaggagatttttatagttgttagcaatttt
tctgagcatccatatcattcttacaaagttggagttccagttgagacagagtacattgaa
gttattaacagtgatgacgaagtgtacggcggttcaggcactgtaaataaaaaggcatta
aaatcagtggatgaatcgtttcacggccaacctttttgcattgaaatgaatattccgccg
tttggcattagtatactacgagcaaagagaaaacgaggggagagaaaacaacatgttaaa
aaagaaatgcgtagcgatgttattggcaggaggaaaaggtag

DBGET integrated database retrieval system