KEGG   Bacillus megaterium WSH-002: BMWSH_0390Help
Entry
BMWSH_0390        CDS       T01890                                 

Gene name
ytpA
Definition
Lysophospholipase, alpha-beta hydrolase superfamily
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMWSH_0390 (ytpA)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BMWSH_0390 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405663..406439
Genome map
AA seq 258 aa AA seqDB search
MHKWEAVNPKGVIVMVHGAAEHHGRYRWLIEMWRSVGMHVIMGDLPGQGLTTRRRGHILS
FDEYVYEVEEWVREAQKYDLPIFLLGHSMGGLAVIRTLQTKNLPIWGAILSSPCLGLKEQ
VPAYLDMLSKGLNKVMPNKLFDLGLTVEKATRNQEVRDEDENDSLYVTKVSVRWYRELIQ
AVNLAFKDIDRLPDVPLLVMQAGEDKIIEKLIVRQWFDEIELSEKIYKEWSQLYHEIFNE
PEREYVFTYAKSFVDLHI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcataaatgggaagcagtaaatccaaaaggcgttattgtcatggtccatggagcagcg
gagcatcacggacgctatcgctggctgattgagatgtggcgttcggttggaatgcacgta
attatgggagaccttcctggccaaggcttaacaacaagaagaagaggacatatcctatcc
tttgatgaatatgtatatgaagtggaagaatgggtacgtgaagcgcaaaaatatgatttg
cctattttcctgttaggtcacagtatgggaggactggcggttattcgtacgctgcagaca
aaaaatctccctatatggggtgcgattctttcctcaccttgtttaggattaaaagagcaa
gtaccagcttatttagatatgttatctaaaggattaaataaagttatgccgaacaaactt
tttgatttgggtctcactgttgaaaaagcaacaagaaaccaagaagttcgagatgaagat
gaaaacgactcactgtatgttacaaaagtttctgtaaggtggtaccgggaattgatccaa
gctgttaacttagcttttaaagatatcgatcgtttgcctgatgtcccgcttcttgtgatg
caggcaggagaagacaaaattattgaaaagctgattgttaggcagtggtttgatgaaata
gaactaagtgaaaaaatctacaaagaatggtctcagctgtaccacgaaatctttaatgag
cctgaaagagaatacgtttttacatatgcaaaaagctttgttgatcttcacatttaa

DBGET integrated database retrieval system