KEGG   Bacillus megaterium WSH-002: BMWSH_0519Help
Entry
BMWSH_0519        CDS       T01890                                 

Gene name
phaB
Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BMWSH_0519 (phaB)
  Lipid metabolism
   00071 Fatty acid degradation
    BMWSH_0519 (phaB)
Enzymes [BR:bmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMWSH_0519 (phaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
537313..538086
Genome map
AA seq 257 aa AA seqDB search
MEIIQVETVDAISFITLNRQPANALSQDLLKDLSSVLKHLEDSKETRVIVIKGEGKFFCA
GADIKEFTSLQQEKEYEKLAVKGQELFEYIENYPKPVIAAIHGAALGGGLELAMSCHIRL
VTENAKLGLPELQLGIIPGFGGTQRLPRYVGVHKACEMMLTSDPISGSEAVELGLANAAF
EESQLINETFLLARKIAKKSPISVKATLQLLQHVKTDAYYSGIKKEAHLFGSVFKSRDAQ
EGVAAFIEKRQPKFLGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggagattatccaggttgaaactgttgatgcaataagcttcattacgttgaatagacaa
cctgctaacgctttgtctcaagatttattaaaagatctttcaagtgttttaaaacattta
gaagatagtaaagagacaagggttatcgttattaaaggtgaagggaaattcttttgtgcc
ggagctgatataaaagaattcacatcacttcagcaggaaaaagaatatgagaagcttgct
gttaagggtcaagagctctttgagtatattgaaaattacccaaaaccagtgattgcagct
attcatggagctgctttaggcggaggattggagcttgctatgagctgtcatatccgtttg
gtaacggagaatgctaagctgggcttgccagagcttcagttaggaattataccagggttt
ggaggaactcagcgattgcctcgttatgtaggagttcataaggcttgtgagatgatgctg
acaagtgatccaatctccggaagcgaggcagtggaattaggattggcaaatgcagctttt
gaagaaagtcagcttatcaatgaaacatttttacttgctagaaaaattgccaaaaaaagt
ccaatctctgttaaagctaccttgcagctgcttcagcatgtaaaaacagatgcttattac
agcggcattaaaaaagaagcgcatctttttggaagcgtattcaaaagccgagatgctcaa
gaaggcgtagccgcttttattgaaaagcgccagcctaaatttttaggaaaataa

DBGET integrated database retrieval system