KEGG   Bacillus megaterium WSH-002: BMWSH_0568Help
Entry
BMWSH_0568        CDS       T01890                                 

Definition
Uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMWSH_0568
Enzymes [BR:bmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BMWSH_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588481..589254
Genome map
AA seq 257 aa AA seqDB search
MSHEAPLFLKKVLITREAKQAHSFAAQIKKLGGIPLSLPVLTFARSNNEKEVENVLLSID
GFDWIVFTSQNGISFFFEWLKELNISWSALKRLKVAAVGEKTAKLLEKHDVNVQLVPKEY
VAESLLESLKANVSHHERVLLVRGQLARSVLKDGLKECEVTDLVVYQTIRNQDSEGLVKQ
HLETGIDAITFTSSSTVRFFVESVKDIPNWLELINRTKVVCIGPITSQTANEYGIKHLVP
NTYTINGMIDMLVSCFE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgaggctcctctttttttgaaaaaagttttgattacaagagaagcgaagcag
gctcattcatttgcagcacagattaaaaagcttggaggcatacctttaagcttaccagtc
ctcacgttcgcacgttctaacaatgaaaaagaagtggaaaatgtcctgctgtcgattgac
ggttttgattggattgtttttacaagtcaaaacggcatttcttttttctttgaatggcta
aaagagttaaatatcagctggagtgctttaaaaagattaaaagtggctgcggttggagaa
aaaaccgcaaaattgctagaaaaacacgatgttaacgtacagcttgttccaaaagaatac
gttgcagaatcacttcttgagtcgttaaaagcaaatgtgtcacatcacgagcgagttctc
cttgtacgaggacaattagcccgctctgttttaaaagatgggttaaaagagtgtgaggta
acggatttagttgtatatcagaccattcgaaatcaagactctgaaggcttggttaagcaa
catttagaaacaggaattgatgccattacttttacaagttcttctacagtgagatttttt
gtcgagtcagttaaagatattccgaattggcttgagcttataaatagaaccaaagttgtt
tgcatcggtcctattacgagtcagacagcgaacgaatatggaattaagcatcttgttcct
aacacatacacaataaatggtatgatagatatgttggttagttgttttgaataa

DBGET integrated database retrieval system