KEGG   Bacillus megaterium WSH-002: BMWSH_0630Help
Entry
BMWSH_0630        CDS       T01890                                 

Gene name
yrrC
Definition
exodeoxyribonuclease V-like protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bmh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656382..658739
Genome map
AA seq 785 aa AA seqDB search
MNEEQVNPSQPERHYISGTSIVTVFHNEENLYNVTRIRIKKTNLEIEDKETVVTGYFPKL
NEDEVYTFYGDFKEHPKFGLQFHVEQFKKELPQSRQGVVQYLSSDLFHGIGKKTAENIVD
ALGERAIFRILQNESVLKEVPRLSADKAEALVTQLREHQGLEEVMVKLTDLGFGPQLSMK
IFQAYKQEALEIVQNNPYQLVEDIQGIGFSRADELGKRLGMATNHPDRLRAGILYVIEQE
CNQMGHVYVTADQLYGKTAELLRKSRHENLSEMDLTREVDALKADKKLIIQDEKIYFPPL
FYAEKGLVKAIQTIMAQTQYEEQFPESEFLLALGELEERLDVQYAPSQRKGIQTALMSPM
LLLTGGPGTGKTTVIKGIVELYAELHGCSLNPGDYKKDEAFPVLLVAPTGRAAKRMSEAT
GLPAVTIHRLLKWNGQEGFDHNEENPIDGKLLIVDEVSMVDLWLAHQLFKSLPANLQVIL
VGDEDQLPSVGPGQVLKDLLSSEVVPTVRLTDVYRQAEGSSIIDLAHEIKKGKLPEDLSR
QQGDRSFIRCQGQHITNVVQQVCGNALKKGYTAKDIQVLAPMYKGPAGIDKLNEVLQELF
NPASEQRRELKHGDITYRVGDKVLQLVNQPDSNVFNGDMGEIVSVFFAKENTEKQDMLVI
SYEGNEVTYTKQDFNQITHAYCCSIHKSQGSEFPIVVLPIVKSYYRMLRRNLLYTAVTRS
KQFLILCGEDEAFQLGVSRNEDSVRQTNLQPLLRESLDNDIEDPEIPFMKDANIGMENVT
PYDFM
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagaacaagtgaacccttcacagccagaacgtcattatataagcggcacgtca
attgtaacggtctttcataacgaagaaaacttatataacgttacgcggatacggatcaaa
aaaacaaatttagagattgaagataaagaaacggttgttacaggctattttcctaagttg
aatgaagatgaagtatacacgttttacggggacttcaaagagcatccaaagttcggcctg
cagtttcatgttgaacagtttaaaaaagaacttccgcaatcaaggcaaggggttgttcag
tacctatctagcgatttatttcacggaatcggtaaaaaaaccgctgaaaatattgtggac
gccctaggagaacgcgctatctttcgtattttacaaaatgagtctgtgctaaaagaggtg
ccgaggctttcagccgacaaggcagaagctttagtcactcagcttcgtgaacatcaaggg
ttagaagaagtaatggtaaagctgacggacctcgggtttggaccgcagctttcgatgaag
attttccaagcgtacaaacaagaagcgcttgaaattgttcaaaataacccttatcagctc
gtagaagatattcaagggattggttttagccgggccgatgaacttggaaagagacttggt
atggcaaccaatcatcctgatcgtttgcgtgcgggtattttatacgtcattgagcaagaa
tgcaatcaaatgggacatgtatacgtcacggcagatcagctgtatggaaaaacagcagag
cttcttcggaaaagcaggcatgagaatctgtctgaaatggatcttacaagagaagtggac
gcattaaaagcagacaaaaagcttattattcaagacgaaaaaatttattttcctcccctt
ttttatgctgaaaaaggactggttaaagctattcaaacaattatggctcaaacgcagtac
gaagagcagtttccagaatcagaatttttactagctctgggtgagctagaagagcgatta
gacgtgcaatatgcaccgtctcagcgcaagggtatacaaaccgctttaatgtctccaatg
cttcttttaacaggtggaccaggtacagggaaaacaacagttattaaaggaatagtcgaa
ctctatgcagaacttcatggatgttcgttaaatccaggggactataaaaaagatgaagct
tttcctgttttacttgtcgcacctactggacgagctgctaaacgaatgagcgaagcgacg
ggacttccggcggttacgattcacagattattaaaatggaacggacaagaaggatttgat
cataatgaggagaatccaattgacggaaaattactgattgtggatgaagtatcaatggta
gatttgtggcttgctcatcagctgtttaaatctcttcctgctaatttacaggttatttta
gttggagacgaagaccagcttccttcagtaggtccgggacaggtgttaaaagatttactg
agttcagaagtagttcctaccgtccgcctgacggatgtatacaggcaagcggaaggatcg
tcaattattgatttggctcatgaaataaaaaaaggaaagcttccggaagacttatcgagg
cagcaaggagatcgttcctttattcgttgtcaaggacagcacatcacaaacgtcgtgcaa
caagtttgcgggaatgcgttaaaaaaaggctatacggctaaagatattcaagttttagct
cctatgtataaaggtcctgcagggattgataaactgaatgaagttcttcaggaattattt
aacccggcttctgagcaaagaagagagcttaagcacggagatattacgtaccgagtcgga
gataaagtgctgcagcttgtaaatcagccggatagcaacgtatttaacggagacatggga
gaaatcgtctcggttttctttgccaaagaaaatacggaaaaacaggatatgctggttatt
tcatatgaaggaaatgaagtaacttacacaaagcaagactttaatcaaataacccatgca
tactgctgttccatccataaatcacagggaagtgaatttcctattgttgtacttccgatt
gtcaaaagctattaccgaatgctgcgacgcaatttgctttataccgccgttacgcgaagt
aaacaatttttaattttatgcggcgaagacgaagcgtttcagcttggagtcagccgaaat
gaagacagcgtccgacaaacgaacctacagcccttgcttcgagaaagcttagataacgat
atagaagatcccgaaattccatttatgaaagatgcaaatattgggatggaaaacgttacg
ccgtatgattttatgtaa

DBGET integrated database retrieval system