KEGG   Bacillus megaterium WSH-002: BMWSH_0734Help
Entry
BMWSH_0734        CDS       T01890                                 

Gene name
glcK
Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMWSH_0734 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_0734 (glcK)
   00052 Galactose metabolism
    BMWSH_0734 (glcK)
   00500 Starch and sucrose metabolism
    BMWSH_0734 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BMWSH_0734 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMWSH_0734 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BMWSH_0734 (glcK)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMWSH_0734 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757599..758573
Genome map
AA seq 324 aa AA seqDB search
MNMDDKWLVGVDLGGTTIKMAFINHYGEIIHKWEINTDVSEQGRKIPTDIAKAIDKKLND
LGEVKSRLVGIGIGAPGPVNFANGSIEVAVNLGWEKFPIKDILEVETSLPVVVDNDANIA
AIGEMWKGAGDGAKDLLCVTLGTGVGGGVIANGEIVQGVNGAAGEIGHITSIPEGGAPCN
CGKTGCLETIASATGIVRLTMEELTETDKPSELRTVLEQNGQVTSKDVFDAARSKDELAM
HVVDKVAFHLGLALANSANALNPEKIVLGGGVSRAGEVLLAPVRDYFKRFAFPRVAQGAE
LAIATLGNDAGIIGGAWLVKSYFE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggatgacaaatggttagttggagttgatttaggcggtacaacaataaaaatg
gcctttattaatcattatggagaaatcattcacaaatgggaaattaatacggatgtgagc
gagcaaggccgtaaaattccaacagatattgcaaaagcaattgataaaaagttaaacgat
cttggagaagtaaaatcaaggttagtaggcattggtattggtgcaccggggcctgtcaac
tttgcaaacggttcgattgaagtagctgtcaatttaggttgggaaaaattccctatcaaa
gatatcttggaagtagaaacttctcttcctgttgtagtagacaatgatgcaaacattgca
gcgattggagaaatgtggaagggtgctggagacggagcaaaagatttactttgcgttacg
cttggcacaggcgttggcggtggcgtcattgcaaatggtgaaattgtacaaggcgtaaat
ggagccgctggtgagatcgggcacattacttctattcctgaaggcggagcaccgtgtaac
tgcggcaaaactggctgtttagaaacaatcgcttcagcaactggaattgtacgtttaaca
atggaagaattaacggaaacggacaaaccaagtgagcttcgcacagtgttagaacaaaat
ggacaagttacatctaaagatgtatttgatgcagctcgttcaaaagatgagttagcgatg
catgttgtagataaagttgcctttcatttaggtctagcactagcaaactctgctaatgca
ttaaaccctgagaaaatcgttctaggcggcggtgtgtctcgtgcaggcgaggtattactt
gcaccggtaagagattatttcaaacgttttgcatttcctcgcgtagcgcaaggtgctgaa
ttagcaatcgctactttaggaaacgatgcgggaattattggaggagcttggttagttaaa
tcttattttgaataa

DBGET integrated database retrieval system