KEGG   Bacillus megaterium WSH-002: BMWSH_0900Help
Entry
BMWSH_0900        CDS       T01890                                 

Definition
strongly GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMWSH_0900
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BMWSH_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
914393..914959
Genome map
AA seq 188 aa AA seqDB search
MSSVNKPQIEQAVRLILEAIGEDPNREGLLDTPKRVAKMYEEVFSGLNEDPKEHFKTVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPKGGRVTGLSKLARAVEAVAKRPQLQ
ERITSTVADSIVETLEPHGVMVVVEAEHMCMTMRGIKKPGAMTITSAVRGVLEQDASSRA
EVLSLIKS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgtaaataaaccacagattgaacaagctgtgagactaattttagaagcaatt
ggcgaagatccaaaccgtgaaggattattagatacaccaaagcgagtagctaaaatgtat
gaggaagtcttttccgggttgaatgaagatccaaaagagcattttaaaacagtttttgga
gaagatcatgaagagctagtgcttgtaaaagatattcctttttactctatgtgtgaacac
cacttagtgcctttttacggaaaagctcatgttgcgtatattccaaaaggcggacgagta
accggtttaagtaagctggcaagagcggtagaagctgttgcgaaacgtcctcagcttcag
gagaggattacatctacagtggcggattctatcgtagaaacattagagccgcacggggta
atggtagtagtggaagcagagcacatgtgtatgaccatgcgaggcattaaaaagcctggg
gctatgacaatcacttctgctgtgcgtggagtgttagaacaagatgcaagttctagagct
gaagttttatcattgattaaatcataa

DBGET integrated database retrieval system