KEGG   Bacillus megaterium WSH-002: BMWSH_0947Help
Entry
BMWSH_0947        CDS       T01890                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bmh00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bmh00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962811..964283
Genome map
AA seq 490 aa AA seqDB search
MVGMDLRELLTHLHDFVQLPEQNIDITSIEMDSREVKPGALFICIDGYTVDGHSFAQMAV
EKGAVAILAEKPVDVEVPVVRVKSTKRAMAVLADAFYNQPTQKMHLIGVTGTNGKTTITH
LIEHIFKSQHKKTGLIGTIEIRIGDTSYDVKNTTPESLTLQKTFHQMVEENVEVAMMEVS
SHALDLGRVHGCDFDVAVFSNLTQDHLDYHHTMEDYRRAKGLLFAQLGNAYNHNRPKFAV
LNADDAATEEYIKNTAATVITYGIDRDSDIRATNIQITNSGTTFDLTTPTETVRVEMKLI
GKFSVYNVLAATASCLVSGIPLSVIVEEIKVLEGVSGRFEVVDAEQDFTVIVDYAHTPDS
LENVLKTVKEFAKRNIYVIVGCGGDRDRTKRPIMARIAAEYSTQAILTSDNPRSEDPLAI
LKDMEEGLDTDNYVTIADRAEAIRYAVETAHADDVIVIAGKGHETYQIIGKKVFDFDDRE
VARKMIEERK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtaggaatggatttacgagaactactaacacatttacatgattttgttcagcttcct
gaacagaatattgatattacgtcaattgaaatggattcaagagaagttaagcccggagca
ttgttcatttgtatagatggctatacagttgatggtcatagctttgcacagatggctgtg
gaaaaaggagcagtagcaatcttagcagaaaagcccgtggatgtagaagtgcctgttgta
cgcgtgaagagtacaaaacgagcaatggcagtactagcggatgctttctacaatcagccc
acacaaaaaatgcatttaattggtgtaacaggcacaaatggaaaaacaacgattacacat
ttaattgagcatatctttaaatcacaacataaaaagacgggtctaattggaacgattgaa
attcgtattggtgatacgtcttatgatgtaaaaaacaccacgcctgaatcgctgacgctc
caaaaaacatttcaccaaatggtggaggagaatgtagaagtagcgatgatggaagtatca
tctcacgcgcttgacttaggacgcgtacacgggtgcgactttgacgtggcggtatttagt
aacttaacgcaagatcatctggactatcatcatacaatggaagattatcgtcgtgcgaaa
gggttgctatttgcacagttaggaaacgcttataaccataatcgtcctaaatttgctgtt
ctgaatgctgatgatgcggcaactgaggaatatattaagaacacggctgctacagtgatt
acctatggcattgaccgtgacagtgatattcgtgcaacaaatattcaaattacaaacagc
ggcacaacgttcgacttgacaacaccgacagaaacggttcgtgtagaaatgaagcttatt
gggaaattcagcgtctacaacgtattagcggctacggcttcatgtttagtatcaggtatt
cctctgtcagttattgtcgaggaaataaaagtgttagaaggcgtgtctgggcgttttgaa
gtggttgatgcggagcaagattttacggttatcgttgattatgcccacacgccggacagc
ttagagaacgtgttaaaaactgtaaaagaattcgcaaaacgcaatatatatgttattgtt
ggttgtggcggagatcgagatcgtacaaaacgaccaatcatggctcggattgcagctgaa
tacagtacacaagctattttgacatctgataatccacgaagtgaagatccattggctatt
ttgaaagatatggaagaaggtttggatacagataactatgtgacgattgctgatcgtgca
gaagctattcgctatgcagtggaaacagcgcatgcagatgatgttattgtcattgctgga
aaagggcacgagacctatcaaattattggtaagaaagtattcgattttgacgatcgagaa
gtagcacgcaaaatgattgaggagcgaaagtag

DBGET integrated database retrieval system