KEGG   Bacillus megaterium WSH-002: BMWSH_1056Help
Entry
BMWSH_1056        CDS       T01890                                 

Gene name
cheB
Definition
Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMWSH_1056 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BMWSH_1056 (cheB)
Enzymes [BR:bmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMWSH_1056 (cheB)
Two-component system [BR:bmh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BMWSH_1056 (cheB)
Bacterial motility proteins [BR:bmh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BMWSH_1056 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074268..1075311
Genome map
AA seq 347 aa AA seqDB search
MNEIKVLIVDDSAFMRKLIGDFLAGDNRFHVVGTARNGEEGLKKAIELSPDIVTLDIEMP
KMNGLDMLKQLMRVKPLPVVMLSSTTIEGAENTLTAMQYGAVDFVAKPSGAISLDLHKVK
DELISKLLLASKANISSSSHQHAQNSSVYNLPMGTKVNKMICIGTSTGGPRALQEVLSTV
SKDINAPIFIVQHMPPNFTKSLAARLNQLSDIEVKEAKDNEIVRSGCAYIAPGGFHMTVV
EKKGQLSICLDTSSPVKGHRPSVDRLFQSISKISGYQKLAIVLTGMGADGTEGVIDLKKN
KDALILAESEETAVIYGMPKSVVSTKLVDYIEPLRNVGSFISRYAQK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaataaaggtgcttattgtagatgattctgcatttatgcgaaagctgattggc
gattttttagcaggcgacaatcggtttcacgttgtgggtacagcacgcaacggtgaagaa
ggattaaaaaaagcaatcgagctatccccagacattgtgacacttgatattgaaatgccc
aaaatgaatggcttagatatgttaaaacagctcatgcgcgtgaagccccttcctgttgtc
atgttatcgagtacaacaatagaaggtgctgaaaatacgctgaccgctatgcagtacggc
gcagttgattttgttgctaaaccttcgggagctatttcgctggacttacataaagtgaaa
gatgagcttatctctaaactattacttgctagtaaagccaacatatcttcaagcagtcat
cagcacgcgcaaaacagcagtgtatataacctcccgatggggacgaaagtgaacaaaatg
atttgtattggcacttctactggaggaccgcgtgcactgcaagaagtattatcaactgtt
tcaaaagacataaacgcacctatttttattgtgcagcatatgccgccaaattttacaaaa
tcattagcagctagattaaatcagctgtctgatattgaagtgaaagaagcaaaagacaat
gaaatcgttcgctcaggatgtgcgtatattgcgcctggaggttttcatatgacggttgta
gagaaaaaaggacagctcagcatttgtttagatacttcttcacctgtaaagggacatcgc
ccctcagtggatcgcttgtttcagtcgattagtaaaatttcaggttatcaaaaacttgct
attgtattgacgggaatgggagcggatggaacggaaggggttattgatttaaagaaaaat
aaagacgcgcttatattagctgaatctgaggaaactgctgtcatttatgggatgcccaaa
tcagttgtttctacaaaacttgttgattatattgaaccactgcgaaacgttggaagcttt
atttctcgctacgcacagaaatag

DBGET integrated database retrieval system