KEGG   Bacillus megaterium WSH-002: BMWSH_1056Help
Entry
BMWSH_1056        CDS       T01890                                 

Gene name
cheB
Definition
Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bmh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074268..1075311
Genome map
AA seq 347 aa AA seqDB search
MNEIKVLIVDDSAFMRKLIGDFLAGDNRFHVVGTARNGEEGLKKAIELSPDIVTLDIEMP
KMNGLDMLKQLMRVKPLPVVMLSSTTIEGAENTLTAMQYGAVDFVAKPSGAISLDLHKVK
DELISKLLLASKANISSSSHQHAQNSSVYNLPMGTKVNKMICIGTSTGGPRALQEVLSTV
SKDINAPIFIVQHMPPNFTKSLAARLNQLSDIEVKEAKDNEIVRSGCAYIAPGGFHMTVV
EKKGQLSICLDTSSPVKGHRPSVDRLFQSISKISGYQKLAIVLTGMGADGTEGVIDLKKN
KDALILAESEETAVIYGMPKSVVSTKLVDYIEPLRNVGSFISRYAQK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaataaaggtgcttattgtagatgattctgcatttatgcgaaagctgattggc
gattttttagcaggcgacaatcggtttcacgttgtgggtacagcacgcaacggtgaagaa
ggattaaaaaaagcaatcgagctatccccagacattgtgacacttgatattgaaatgccc
aaaatgaatggcttagatatgttaaaacagctcatgcgcgtgaagccccttcctgttgtc
atgttatcgagtacaacaatagaaggtgctgaaaatacgctgaccgctatgcagtacggc
gcagttgattttgttgctaaaccttcgggagctatttcgctggacttacataaagtgaaa
gatgagcttatctctaaactattacttgctagtaaagccaacatatcttcaagcagtcat
cagcacgcgcaaaacagcagtgtatataacctcccgatggggacgaaagtgaacaaaatg
atttgtattggcacttctactggaggaccgcgtgcactgcaagaagtattatcaactgtt
tcaaaagacataaacgcacctatttttattgtgcagcatatgccgccaaattttacaaaa
tcattagcagctagattaaatcagctgtctgatattgaagtgaaagaagcaaaagacaat
gaaatcgttcgctcaggatgtgcgtatattgcgcctggaggttttcatatgacggttgta
gagaaaaaaggacagctcagcatttgtttagatacttcttcacctgtaaagggacatcgc
ccctcagtggatcgcttgtttcagtcgattagtaaaatttcaggttatcaaaaacttgct
attgtattgacgggaatgggagcggatggaacggaaggggttattgatttaaagaaaaat
aaagacgcgcttatattagctgaatctgaggaaactgctgtcatttatgggatgcccaaa
tcagttgtttctacaaaacttgttgattatattgaaccactgcgaaacgttggaagcttt
atttctcgctacgcacagaaatag

DBGET integrated database retrieval system