KEGG   Bacillus megaterium WSH-002: BMWSH_1068Help
Entry
BMWSH_1068        CDS       T01890                                 

Gene name
dxr2
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase 2
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMWSH_1068 (dxr2)
Enzymes [BR:bmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BMWSH_1068 (dxr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084658..1085806
Genome map
AA seq 382 aa AA seqDB search
MKKISLLGATGSIGTQTVDIVRAHPEYFELSAISVGRNINEARKIIQQCKPTLVSVMKKE
DCLSLQAEFPSIRFVYGEEGLVEVATHPSTEVLVNAVLGSVGLTPTLEAIKMRKTIAIAN
KETLVTAGHLVMEAAKEYGADILPVDSEHSAIFQSLQGQDQKAIDRLILTASGGSFRDKT
RAELQGVTVEDALNHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDLPYEKIDVLLHKES
IIHSMVEYSDTSVIAQLGTPDMRVPIQYALTYPKRMSLPNTKRLSLADIGQLHFAKMDEE
RFRCLAFAFEAGKAGGTLPTVLNAANEEAVQAFLDGHITFLQIEDVIEKAMNEHTVIQKP
CLSTIKEVDLEAREFVRSAISR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaatttccttgttaggagctacaggttcaatcggtactcaaaccgttgatatt
gttcgagcgcatcctgagtattttgagctctcagcaatctctgtaggtcgaaatattaat
gaagcaagaaagattatccagcagtgtaagccaacccttgtttctgtgatgaagaaagaa
gattgtctgtcactgcaagcagaattcccttctattcgatttgtttatggagaagaagga
cttgtggaagtggcaactcatccatccacagaagttttagtaaatgctgttcttgggagt
gtagggttgactcctacgctagaagcaatcaaaatgagaaaaacgattgctattgcaaat
aaggagacacttgttactgctggtcaccttgttatggaagcagccaaggaatatggcgct
gatattttaccggtagacagtgagcactcagctatttttcaaagtttgcaagggcaagat
caaaaagcaatagaccgtttaattttaacggcttctggagggagctttcgagataaaacg
agagcagaactacagggagtaacggttgaagatgcattaaatcatccaaactggtcgatg
ggagctaaaattacaattgattcggcaacgatgatgaataagggactagaagtgattgaa
gcacattggctttttgatcttccctatgagaaaattgatgtattgttacataaggaaagc
atcattcattctatggtagagtattcggatacaagcgttattgctcagcttggaacgcct
gatatgcgcgtgccaattcaatacgcattaacgtatccaaaacgcatgtctttgcctaac
accaagcgtttaagcttggcggatattggccagcttcacttcgctaaaatggatgaagag
cgttttcgctgtttagcttttgcatttgaggctggcaaagcgggtggaacacttccgact
gttttaaatgcagctaatgaagaagctgttcaagcctttttagatggtcacattacattt
ttacaaattgaagatgtgattgaaaaagcaatgaatgaacatactgtaatacagaaacct
tgtttatctactattaaagaagtagatttagaagcaagagagtttgttagatccgccatc
tctcgataa

DBGET integrated database retrieval system