KEGG   Bacillus megaterium WSH-002: BMWSH_1166Help
Entry
BMWSH_1166        CDS       T01890                                 

Gene name
dfrA
Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bmh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201243..1201728
Genome map
AA seq 161 aa AA seqDB search
MISLIVAMDQNRLIGKENDLPWRLPEDLKYFKRITTSHTIVMGRKTFESIGRPLPNRENV
VLTRQKDYQQEGATVIHSVEELEALDAEKEDELFVIGGATLYEQTLDVANRLYITHIEES
FEGDTHFPAVNLSEWRVISKQQGIKDEKNPYTYYFTVYERS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctcattgtcgcaatggatcaaaataggctgatcggtaaagagaatgatttg
ccatggcgtcttcccgaagatttaaagtatttcaagcgcatcacaacgagtcatacgatt
gtaatgggaagaaaaacatttgaatcaattggacgaccgcttcctaatcgcgaaaatgtg
gttcttacgcgtcaaaaagattatcaacaagaaggagcaaccgttattcattcagttgag
gaactagaagcattagatgctgaaaaagaagacgagctgtttgtgattggtggagctact
ctgtatgagcaaacattagacgttgcaaaccgactttatattacgcatattgaagaatcg
tttgaaggagatacacattttcctgcggttaacctgagcgaatggagagttatttcgaag
caacaaggaattaaagatgaaaaaaatccctacacgtattattttacagtatacgagcga
agctaa

DBGET integrated database retrieval system