KEGG   Bacillus megaterium WSH-002: BMWSH_1235Help
Entry
BMWSH_1235        CDS       T01890                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
bmh00010  Glycolysis / Gluconeogenesis
bmh00030  Pentose phosphate pathway
bmh00051  Fructose and mannose metabolism
bmh00052  Galactose metabolism
bmh00680  Methane metabolism
bmh01100  Metabolic pathways
bmh01110  Biosynthesis of secondary metabolites
bmh01120  Microbial metabolism in diverse environments
bmh01130  Biosynthesis of antibiotics
bmh01200  Carbon metabolism
bmh01230  Biosynthesis of amino acids
bmh03018  RNA degradation
Module
bmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bmh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMWSH_1235 (pfkA)
   00030 Pentose phosphate pathway
    BMWSH_1235 (pfkA)
   00051 Fructose and mannose metabolism
    BMWSH_1235 (pfkA)
   00052 Galactose metabolism
    BMWSH_1235 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BMWSH_1235 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMWSH_1235 (pfkA)
Enzymes [BR:bmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMWSH_1235 (pfkA)
Protein phosphatases and associated proteins [BR:bmh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BMWSH_1235 (pfkA)
Messenger RNA biogenesis [BR:bmh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMWSH_1235 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEN88119
UniProt: G2RK23
Position
1261300..1262259
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNPAVRAVVRKAIHEGMEVYGIYQGYQGLIEGNIKKLEVGDVGDI
IQRGGTMLYSARCPEFKTEEGRLKGIENLKKHGIEGLVVIGGDGSYMGAVKLTELGFPCI
GIPGTIDNDIPGTDFTLGFDTALHTVIDAIDKIRDTATSHERTFIIEVMGRNAGDIALWS
GLAGGAETILIPEAKDEFQEMVDRLRKGQERGKKHSIIVVAEGVANGNEVAKQLHEAAGI
ETRVTVLGHIQRGGSPTAQDRVLGSRFGGRAVELLLEGKGGRAIGIRKNEIVDYDIMEIL
GEPHHINADMYRLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaataggtgtattaacaagcggcggagattctccaggtatgaatcctgcggtt
cgtgctgttgtgcgtaaagcaattcatgaaggtatggaagtttacggtatctatcaagga
tatcaagggttaatagaaggaaatattaaaaagctggaagttggagatgttggtgacatc
attcaacgcggtggaactatgctttattctgcaagatgtccagaattcaaaacagaagaa
gggcgtttaaaaggtattgaaaaccttaagaagcacggtattgaaggcttagtagttatt
ggtggagacggatcgtatatgggagctgtaaaactaacagagcttggtttcccttgtatc
ggtatcccaggaacaattgataacgacattccaggaacagattttacattaggatttgat
acggctcttcatacggttatcgatgcaattgataaaatccgtgatacggcgacttctcat
gaacgtacgtttattattgaagttatgggtcgtaatgcaggagacattgctctttggtca
ggtcttgctggcggtgcggaaacaatccttatcccagaagcaaaagatgagttccaagaa
atggttgatcgtttgagaaaaggacaagagcgcggtaaaaagcacagcattatcgtagta
gctgaaggtgtagctaatggtaatgaagtagcgaagcagcttcatgaagctgcaggtatt
gaaacgcgtgtaacagtattaggacacattcagcgcggtggttccccaactgctcaagat
cgcgtgctaggaagccgtttcggcggtcgcgcagtcgaacttctactagaaggtaaaggc
ggccgtgcaatcggtatccgtaaaaatgaaattgtagattatgatattatggaaatttta
ggtgaacctcaccatatcaatgctgatatgtaccgtttatctaaagaactttcaatctaa

DBGET integrated database retrieval system