KEGG   Bacillus megaterium WSH-002: BMWSH_1313Help
Entry
BMWSH_1313        CDS       T01890                                 

Definition
Pyridoxal phosphate-dependent deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bmh00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1339368..1340360
Genome map
AA seq 330 aa AA seqDB search
MNLTQFSRRKYTDFPTPLEKLPVLSQQLNGPSIYMKRDDMLGLTGGGNKTRKLEYLIADA
KAQGADVLVTCGAIQSNHCRLTLAAAVKEQMKCVLVLEEGENKASDQPTGNYFLYHLLGA
HDMRFVAEGSDLTAEMEKVARELSEKGHKPYLIPVGGSNVIGATGYAACAQELLMQSYEQ
QIKLSHVVCTSGSGGMHAGLVAGFQGLQSGVSVIGMNVSRAKEEQEMKVAKLTSELYDHL
HSKTPFKKEDIVCMDEYVGPGYAVPTEEMVEAVKLVASTEGILLDPVYTGKAMAGLIDLI
RKGYFKKDENVVFVHSGGSPALYAYTSIFS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaactcaattttctagaagaaaatatacggatttccctacacctttagaaaag
ctaccggttttatcgcagcagttaaacggaccttcaatttatatgaagcgcgatgatatg
cttggactgacagggggcggaaataagacgcgtaagcttgaatatttaatagcagatgca
aaagcgcaaggagcagacgtgcttgtaacgtgcggagcgatacaatctaatcactgccgt
ttaacgctcgctgctgccgtaaaagagcaaatgaaatgcgtgctcgtattagaagaagga
gaaaataaagcaagcgatcagccgacgggaaactattttctttatcatttattaggcgct
catgacatgcggtttgtcgctgaaggttctgatttaacagcggaaatggaaaaagtagcg
cgcgagctaagtgaaaaaggtcataagccgtatttaatcccagtaggaggttcgaatgtc
attggtgcaacaggctacgctgcctgcgcacaggagctgcttatgcaaagctatgagcaa
caaataaagcttagccacgtagtttgtacaagcggcagcggaggcatgcatgcaggatta
gtggcaggctttcaaggccttcaaagtggcgtgtctgttattggaatgaatgtgagtcgt
gctaaagaagagcaagaaatgaaagttgccaagctaacgagcgaactttatgatcattta
catagtaaaacgccttttaaaaaagaagacattgtgtgtatggatgaatacgtcggtcca
ggctatgctgttccgacagaagagatggtggaagcagtcaaacttgtggccagtacggaa
gggattttattggatcctgtgtatacaggaaaagcgatggccggtctgattgatttaatt
cgaaaaggttattttaaaaaagatgaaaatgtggtgttcgtccattcaggaggttcaccg
gctctttatgcatatacatcaattttttcataa

DBGET integrated database retrieval system