KEGG   Bacillus megaterium WSH-002: BMWSH_1324Help
Entry
BMWSH_1324        CDS       T01890                                 

Gene name
rocF
Definition
arginase/agmatinase/formimionoglutamate hydrolase arginase family-like protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bmh  Bacillus megaterium WSH-002
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352774..1353673
Genome map
AA seq 299 aa AA seqDB search
MKKDISIIGVPMDYGQTRRGVDMGPSAIRYAGMNTRLEALGYTVHDEGDIKVEIKERADV
DKNTNLKNLAAVASGNEQLAARVEEVREQDRFPLILGGDHSIAIGTLAGVAKGSENLGVI
WYDAHGDLNTAETSPSGNIHGMPLAVSLGIGHPVLLNIGGYTPKIKPENLVIIGARSLDD
GEKELIKEKGIKVYTMHEIDRLGMTQVMKETIDYLSGTDGVHLSLDLDGLDPDDAPGVGT
PVKGGISYRESHLAMEMLAEADIVTSAEFVEVNPILDQHNKTAEVAVALMSSLFGDKLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagacatttcaattatcggtgtacctatggattacggacaaacaagaaggggc
gtagacatggggccgagcgcaatccgctatgcgggcatgaatacacgcttagaagctctt
ggctataccgtacacgatgaaggcgatattaaagtagagattaaagaacgggcagacgta
gataaaaatacgaatctaaaaaacttagcggctgtagccagcggaaatgaacagctggct
gcaagagttgaagaagtgagagagcaagaccgctttccgttaatattagggggagaccac
agtattgcgattggaacgcttgcaggagtggcaaaaggttcagaaaatttaggcgttatt
tggtatgatgctcatggtgatttaaataccgctgaaacatctccatcaggcaacattcac
ggcatgccgctagcagtgagcctgggtattggacatcctgtacttttaaatattggaggg
tatacaccaaaaattaaacctgaaaatctagttattatcggtgcgcgctcgttggatgat
ggtgaaaaagagttaattaaagaaaaaggaattaaagtgtataccatgcacgaaattgat
cgtttaggtatgacgcaagtgatgaaagaaacgattgattatttaagcggtacagacggt
gtgcacctgtcgttagacttagacggcttagatccagatgatgcaccaggcgtaggtaca
cctgtaaaaggcggcatcagctaccgagaaagtcatttagcaatggaaatgctagcggaa
gcagacatcgttacatccgctgaatttgtagaagtgaaccctattttagatcagcataac
aaaactgcagaagtagcggttgcgttaatgagttcattgtttggcgataagcttttataa

DBGET integrated database retrieval system